EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05365 alignment
(6 sequences with 57 aa)


Q9XFY0_CHLPR/4-60 LDVFYKTIVRRNSVYVGFILVGAFFGEQAVDKVGNSLWESNNKGKLFKDIVASQQEA
UCR10_SOLTU/13-69 LEGFYRLVMRRTPVYVTFVIAGALLGERAVDYGVKTLWEKNNVGKRYEDISVLGQRP
Q8SY81_DROME/1-55 MKVIYNTLFKRASTYAVAIIASAFFFERALDVTSVAIFESINKGKLWKDIKGKYE--
UCR10_BOVIN/6-62 TARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK
UCR9_YEAST/2-58 FSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAAG
UCR9_SCHPO/3-59 SSTIYNIFFRRNSSFYATIFVSAFFAKIGFDVFTDSVWKRANAGLTWDEVKPRFLNK