EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05361 alignment
(4 sequences with 147 aa)


PP14A_RAT/1-147 MAAQRLGKRVLSKLQSPSRARGPGGSPSGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGREADMPDEVNIDELLELDSEEERCRKIRGLLEACLNPTEDFVQELLAKLRGLHKQPGFPQPSPSDDPSLSPRQDPAHTAPP
PP14A_MOUSE/1-147 MAAQRLGKRVLSKLQSPSRARGPGGSPSGLQKRHARVTVKYDRRELQRRLDVEKWIDGCLEELYRGRESDMPDEVNIDELLELDSEEERCRKIQGLLEACANPTEDFVQELLAKLRGLHKQPGFPQPSPSDDPSLSPRQDRAHTAPP
PP14A_HUMAN/1-147 MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLSPLQDRARTAHP
PP14A_PIG/1-147 MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGREADMPDEVNIDELLELESEEERSRKIQGLLKSCTNPTENFVQELLVKLRGLHKQPGLRQPSPSGDGSLSPRQDRARTAPP