EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05354 alignment
(3 sequences with 117 aa)


O64324_BPN15/1-117 MADFDNLFDEAMSRADGAIRGVMGTEAKVMSGTLSGATLVGVFDDPENIGYAGAGIRVEGTSPTLFVKTSTVSQLQRMDTLTINGRQFWVDRVGPDDCGSCHIWLGNGTPPASSRRR
Q8X296_ECO57/1-117 MADFDNLFDAAIARADETIRGYMGTSATMTSGERSGAVIRGVFDDPENISYAGQGVRVEGSSPSLFVRTDDVRQLRRGDTLTINGEMFWVDRVSPDDGGSCYLWLNRGQPPAVNRRR
Q8ZN00_SALTY/1-117 MSQSENLFDTAISQADDAILRVMGTVATITSGVLAGATLTGVFDDPESVSYAAGGVRIEGDKPTFFVKTSLTVHLKRPDTLTILGDTFWVDRITPAGGDSSIILLGRGTPPTDNRRR