EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05352 alignment
(3 sequences with 281 aa)


Q9FZW5_BPGA1/7-287 SYKTIGEIQRRRGNLWFRTYQRYLFSLAYQMFEWQGLPKTVDPIFLEKQLHQRGFVAFYKDEMYGYLGVQGTLSGQINLYNQPNFYTASAPTYQKSFPLYWYDMGEDLNEKGQGIVIYNNLERMPTLDILNLYAMNLAELKETIYVNQNAQKTPVIIKAGDNDLFSMKQVYNKYEGNEPVIFAGKKFNTDDIEVLKTDAPYVADKLTMLFKDQWNEAMTFLGLSNANTDKKERLIQSEVESNNDQIQGSANIYLAPRQEACRLINEYYGLNVSVKLRKELV
VG10_BPPH2/8-285 TYRSINEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFGYVGFYKDPVISYIACNGALSGQRDVYNQATVFRAASPVYQKEFKLYNY---RDMKEEDMGVVIYNNDMAFPTTPTLELFAAELAELKEIISVNQNAQKTPVLIRANDNNQLSLKQVYNQYEGNAPVIFAHEALDSDSIEVFKTDAPYVVDKLNAQKNAVWNEMMTFLGIKNANLEKKERMVTDEVSSNDEQIESSGTVFLKSREEACEKINELYGLNVKVKFRYDIV
VG10_BPB03/7-284 SYKSINDIQRMRGNRWYYHYYQYLCSLAYQLFEWERLPPSVDPSYLEKSIHQFGYVGFYKDPRIGYIACQGALSGTVDHYNLPDRFHASSVGYQNTFKLYNY---SDMKEKNMGVAIYNNDLKCSTLPALEMFAQDLAELKEIIAVNQNAQKTPVLIAANDNNQLSLKNIYNQYEGNAPVIFVHESLDLDNLKVFKTDAPYVVDKLNAQKNAVWNEVMTYLGIKNANLEKKERMVTSEVDSNDEQIESSGNIYLKARQEACNKISELYGLNLKVKFRYDIV