EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05348 alignment
(7 sequences with 134 aa)


UMP1_YEAST/18-148 DKSVLSSAVPSLPDTLRQQEGGAVPLSTQLNDRHPLESTLKN-WETTQRQRQMEQYRQIFGIAEPMKRTMEMEIVNRTDFNP-LSTNGSIHRDILLNKECSIDWEDVYPGTGLQASTMVgDDVHSKIEKQLGI-
UMP1_SCHPO/3-129 IVPDVEPAAEVSGNFKVSVLEPSIPAVHRVENKHPLESRLKN-WEAQQQQIRLDSMRRIYGLHEPVRREMEQKLASQSSRPLALGGSANFHLDILANREAVLDETDIYAAPIPLEMTY-.---QNEMAIRYGL-
Q8MPE9_TAESO/8-138 KLSRNEFGLVSAMYNGLAANRGLISEVDAVAAPHPAAAAEAQRGEAAQRMQSMRVLRSTQGLHAPLRLAMEERVMERMAPRLPGIYTHHPLAAQLSGALDTIDFCDILNSPEDAEVMVS.--PHLLMERQQGIL
Q9VIJ5_DROME/5-133 SLKVQPAEVSVLNATGRVGMPTEANCLNQLAHVHRLRDSELN-YNEHQYNRNMQMLRNHEGLGVPLKMGMERFAARQVGRLP-FLSSSNFMDDVLTGRCDSIGFEDFMNLPENSEHMR-.-QPHAVVEKSLGIY
Q9CQT5_MOUSE/13-141 SIPVAELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKN-FQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVHRLP-FLPSSNLSLDILRGNDETIGFEDILNDPSQSELMG-.-EPHVMVEHKLGLL
Q94B05_ARATH/3-132 SEKKIAHEIGGVKN--DALRFGLHGVKSNIIGSHPLESSYES-EKKSKEALKRTVIAHAYGTALPLKMDMDRQILSRFQRPPGPIPSSMLGLEVYTGAVDDFGFEDYLNDPRDSETFKP.VDFHHGMEVRLGIS
O65048_PICMA/4-132 VQQSLPHEIGGIT---DTLRFGLAGVKSDILISHPVQVIQEN-AQKQQREMKRNILAKTYGSAFPLKMDIEQQILSRFQRPPGELPSSMLGLESLTGSLDEFSFEDYLNDPRESETFVP.ADMHHGMEVRLGLS