EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05321 alignment
(6 sequences with 61 aa)


Q9F547_ECOLI/16-72 FQLRRCSTLDTLEKIIEKNQNCLPPS-ELESFNAAADHRLAELTMN-KLYD--KVPPSVWK
HHA_ECOLI/13-69 MRLRRCQTIDTLERVIEKNKYELSDN-ELAVFYSAADHRLAELTMN-KLYD--KIPSSVWK
O32581_ECOLI/10-66 YQLRRCSSANTLEKIIRKNRDSLLNS-ERESFNSAADHRLAELITG-KLYD--RIPKEIWK
Q935M6_SALTI/10-66 MKFRKCSSFDTLEKVFERLCEKNAGI-ASLEISGAYDHRKAELTMK-KLYD--KVPASVWT
Q8XGJ8_SALTI/8-68 LKFRKISSLESLEKLFDHLNYTLTDDMDIVNMYRAADHRRAELVSGGRLFDVGQVPQSVWR
Q47498_ECOLI/14-70 HTVRRFMNEDSLDTYVDSKRDVLPAT-EFMRLLTAAEHRRVEIRTG-KLFD--KIPKGLFR