EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05309 alignment
(3 sequences with 195 aa)


O85947_SPHAR/1-184 MDLSISHGQAQRLLKQRNLLAITATGLFALSVVLTFTAA-----------HRDREVVLQPVLAKPLTLSSSHIDKDYLELVTRDAALLTLNRSPSNLQYWMDSILAITDPRTHGRMKAELMKIFNEQNGSNVSQFFTIENLSVDPEALTSEVNGVLHTVVGSKEVTSEARTFRYVWSYSGVSLKLAGFGRVTKDP
TRE1_SALTI/1-187 MEISARNSSTK-------IIAVIILSLTTLVFILGFAVAWL-AVTNRALIHEQRTVVTPMTYNAPFVVSETKADTEYFRMMTLSFLALRLNVSPETVDSNHAFLMSFVEPEAREEFKKVLQEEAAQIKANDVNSTFYTTEINVYPVDGRIDVRGVLKMWIGNSRPSTEIKTYRLRLKYTGGFTRIGRFYEVTNEK
Q46998_ECOLI/1-187 MEHGARLSTSR-------VMAIAFIFMSVLI-VLSLSVNVIQGVNNYRLQNEQRPAVTPMGFNVPFAVSQNSADASYLQQMALSFIALRLNVSPEIVDASHQALLQYIRPGAQNQMKVILAEEAKLIKKDNVNSAFFQTSVRVCLSMVVWKFRGIRKTWIGNSEPFTDIKHYILILKRENGVTWLDNFGETDDEK