EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05301 alignment
(5 sequences with 123 aa)


Q9VSY4_DROME/72-191 SDN-QTIYLLADNEA--GHNGAVLGLLKVGTKNLYLFDEAGKTRMVEQTPSILDFYVHESRQRAGLGKRLFQTMLNEEQWTARKCSVDRPSEKLLSFLSKHYGLKRIIPQANNFVLYEGFFND
Q9W5X9_DROME/77-195 ASD-QVVYLMADKAA---GHWEITGLLKVGTKDLFVFDQGGCYRRLNQTPAILDFYVHESRQRCGQGKLLFEWMLEKQGWSAHKCTVDRPSNKMLAFMAKHYGLVRTIPQGNNFVLYEGFFDD
Q9DCR0_MOUSE/3-123 SNR-HVIYILKDTSARPAGKGAIIGFLKVGYKKLFVLDDREAHNEVEPL-CILDFYIHESVQRHGHGRELFQHMLQKERVEPHQLAIDRPSPKLLKFLNKHYNLETTVPQVNNFVIFEGFFAH
Q23192_CAEEL/64-183 HDEEQTTYIMWEKVN--GSKSILKGLLRVGYKTLYLTDNEQNQYM-EKAMCILDFFVVPTEQRSGNGFKMFDEMLKAENVTVDQCAFDKPSAALQQFLEKYYDRKDLVWQSNKYALCSNFFIG
O45100_CAEEL/61-179 SDS-TLYLSWKYDEE--EKVSRLMGFAKVGRKKLFLYDSQMQTYE-GEILCLLDFYVHFSCQRQGVGQQILDYMFSQEHTEPYQLALDNPSVTLLGFMSQKYGLIKPVWQNTNFVVFEELFLA