EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05275 alignment
(9 sequences with 261 aa)


Q9PH13_XYLFA/84-324 IHGATTQFAGDGSLPPPSAAAL----------AAAFPPLRHRAA--HAPPLVSLVRIDRLETWNADPGRGHAWATQAWIGSDIQRLWLRSQGECYGGR-CQSVAVEMLYGHDISPWWDALIGARRD-VQPD--GRTWAALGVQGVAPYKFESAAFLYLS-GAAMRLMVETKYDLLLSQRLILQPSLQATAGLTRD--RDLG.AGPQTLQVGIRMRYQITRRVAPYVGWEREYGYGESGRQARARGTSDHEKRWVAGIRCWF
Q8PCX5_XANCP/247-491 HTAPAATRSPREPIPTPTADDI----------AAAFAPLRSHAM--HGAGINHYVLLDRLEASDNHTGSGQDWEARAWLGGDIDRLWLRSEGERRRDQ-THDASLEAFYGHAISPWWDVLLGARQD-LAPGQ-RQSWAAIGVQGLAPYKFETEATLYLGSGGRAAFRLEAEYDVLLTNRLILQPRVEADVALTDDDRRGIG.SGLEEVEAGLRLRYEITRKFAPYIGWVHSRRFGDSAQRADGDDTPARESRFVAGVRVWF
Q8PGI5_XANAC/121-364 TETRT-NPLPRAPIPPTTADDI----------AAAFAPLRTHTM--HSAGINHYVLLDRLEASNTNRGSGQAWESRAWIGGDVDRLWLRSEGERHDGR-TESASLEAFYGHAISPWWDVLVGARQD-IGAGE-HRSWAAFGVQGLAPYKFETEATLYVGTGSRAALRLEGEYEVLLTNRLILQPRVEADIALTDDNRRGIG.SGLEQVELGLRLRYEITRRFAPYIGWMHSRSFGDSAQRAAMDDIRARDSRFVAGVRVWF
Q56796_XANCA/96-339 GHSAT-TSEPRTPIPKVTDIDR----------AAAVPPPSDHPV--HDNTIQHYVLFNRLEAWNADPGTGQAWEGQSWIGTDLNRLCVRSEGERNDGR-TEAADLEVLYGRSVAPWWDLVAGIRQD-FKPGS-SQTYAAFGVQGLAPMKFEVAATAYIGERGQTAARLEAEYELLLTNRWILQPLAEIELFGKDDPARGIG.SGLSTAELGLRLRYEFTRQFAPYIGLVYERAFGNTADLRRDESERVDDTRIVVGIRTWF
PCOB_ECOLI/52-296 TSMEPIVTESRTPIPPVTDADR----------KAAFGNLQGHAI--HDSAINYLVLLDQLEWQRSDNTNNFSWSVNSWIGGDTDRIWLKSEGERSNGE-TEAAEAQLLWGHAVGPWWDLVAGVRQD-FRPAS-ARTWAAVGFQGLALYNFESEITGFVSNGGKAALRLGGEYDVLLTNRLILQPSYEVNFYSQDDESRGRG.RGLTDTELGLRLRYEIRREFAPYIGVSWNQLYGKTSDMAKREGEKDHQVVFLAGARIWF
Q9F3S0_9BURK/206-462 MDHGAMQMQGGSRPPDARDPDAYSDGAKLGVGQYAIGPSRSLHM--ADEHIFASVLVDRLEWTKGNESNAASYEAQAWIGNAFNKFVIKAEGEVEKGK-VPEARTELLWGHAIATYWDTQLGVRND-AGYGRPARNWLAFGVQGLAPYWFEVEATGYVGTEGRTAVRLSGEYDLLLTQRLILQPRLEASLYGKNDPEIGNRlSGLSSGAVGVRLRYEFSRQFAPYIGIERSQSFGNTANMVRASGGRSGETRFVAGIRMWF
Q8XS24_RALSO/91-346 MDHGSMNMQGGSAPPDARDPDAYSNGYRLGAGPYALGDTRHLMM--ADEHRFASVLVERLEWAHGNGTNATAYDAQAWFGTSYDKLVIKAEGDIHKGR-VEEARTELLWGHAIAPFWDTQLGLRND-AGTGRPGRSWAAFGVQGLAPYWFHLEATAYVGDSGRTALRLSSEYELLLTQRLILQPRLEASFYGKRDPALEIG.SGLSSGTLGLRLRYEFSRQFAPYVGVERSQAFGGTANLIEAAGGRRGETRVVAGVRFWF
Q9A9L5_CAUCR/66-302 PHAGHHMHHAPPPIPTDHAAER-------FYSPAVMAAARAQLMKEHGGGTAWIVRADVAEQRFRKGDDAQAFEGQAWWGTDASKWVVKARGERVDGHGWEKAELEGLKAWPIGPYFDLQAGLRYD-LAPK--GRSYAAVGFEGLAPYWFELHGAAYVSDRGDVSARAEASYDLRLTQRLILQPRLEADL-----AEAGAG.----RLEGGLRLRYEIKREFAPYVGVVRERAFGP----AREAGERAGATAVVIGVSAWR
Q9L913_9GAMM/31-284 PVSGYHPDLTATVEAQPRDPHEYSDGLTLSSGPSLFEGREKLSL--ADEHVFSSMLVDRLEYSSGREENYANYKALAWIGKDYQKIWFKSDGEY-KNS-LQETENQILYGYAISSYWDVLMGARYDTYKARV-IRDGLHLVFRGFAPYWFELDSSLFVDSHGLALLSLEAEYDLLLTQKLI-QPQVSVNIYSKDDSDMSVG.RGVSDLSAGLRLRYEINRQFAPYIGVEWKTLAGGTYDIAKDNEESTSDTRFITGARFWF