EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05256 alignment
(7 sequences with 89 aa)


Y884_STRP3/3-90 GNYYYPLDLSWSTEEISSVLHFLNKVELAYEKKVDAKQLLDSYKTYKTIVKSKAQEKQIDRDFQKVSGYSTYQVVKKAKAI-EKGFFSL
Y1404_STRPN/3-90 KQYSYPLDLSWSTEELASVLSFFNDVEAAYEGKVEAKKLLDSYKGFKAVVPSKSEEKRLGREFETVSGYSLYRAVQAAKEK-GEGKISL
YFDD_LACLA/3-90 ENYNYPLDLSWSTTEMTEVLSFFNQVEKFYESKVEKEVFLESYNAFKKIVPSKMQEKQLGRDFELSSGYSLYHAVKEVKAS-GKRFVSA
Y980_STAAW/1-89 MEYEYPIDLDWSNEEMISVINFFNHVEKYYESGVTAGDFMGAYKRFKEIVPAKAEEKQIFNTFEKSSGYNSYKAVQDVKTHSEEQRVTA
Y1058_LISMO/1-88 MEYSYPLNPDWTTEEMTIVVQFLEAIERAYEKGIDTLELKEKYRAFKQVVPAKGEEKRIGIDFEKASGYSAYKVMQLVKNA-TTSKIKM
YKTA_BACSU/1-88 MEYQYPMNEDWTTEEAVDVIAFFQQVELAYEKGADREELLKAYRRFKEIVPGKAEEKKLCGEFEEQSTYSPYRTVKQARES-DHAKIKM
Y2638_BACHD/1-88 MKTTLPISLDWSTEEVIDVVHFFQAIEQAYDQGIAREDLLGKYRRFKEIVPSKSEEKQLFRAYEQENDVSCYQTIKKAREE-MEEHIQM