EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05251 alignment
(3 sequences with 79 aa)


U197_DROME/1-78 MDVMQRYVSPVNPAVFPHLATVLLVIGTFFTAWFFIFVVSRKSSKES-TLIKELLISLCASIFLGFGIVFLLLTVGIYV
CK010_MOUSE/3-79 LEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVT--STKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV
U197_CAEEL/3-79 ISKMNRYTAPVNFASLPLLTTFLCGVGLLLLATFTMIQVT--STKYNRNLLKELFIAATSSVFLGFGSVFLLLWVGIYV