EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05216 alignment
(6 sequences with 246 aa)


YK10_YEAST/35-273 QQSVPMVIRRLFKTPKNLDLETASWEMFHLIFHPRKAYRSIYYQRQTKNQWARDDPSFFIFQIALISLSSIIWSIYNSGFNNDSDMGALSIIGHFFKSLVMMVILDFFIFGFIMATIFYLLLNRSHFKF----KSSQNSVVEWAYCFDVHCNSFLIILLCLYFIQFLLLP-IINLQNWISLLIGNSLYCFAIGHYFILTFYGYNQLPFLKNLNFILLPTLGLSIIYLISL-FGIDLSKKL-SFYNY
Q9VHN5_DROME/45-272 TTKSYKYLRRLLKF-NQMDFEFALWQMLYLFVAPQKVYRNFNYRKQTKSQFARDDPAFLVLLVVCLCVTSLGF-------AYVLGLSFWQ----SISFIFYVVFVDCIFVGIIIASFFWAVTNRYL-RT-----NSLEPDIEWGYAFDVHLNAFFPPLMLLHFIQLFFYNWLISQTWFISRFLGNTFWLMGMGYYVYITFLGYNCIPHLKNTRIILIALPIIFLLFLVVTIIGWNATISFVNFYKY
Q9UQF4_HUMAN/28-256 GAKRYKYLRRLFRF-RQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGF-------GFVLDMGFFE----TIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKR-----QSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKY
YRT2_CAEEL/61-287 FAKLSRFTRRLVHI-RQMDFEFALWQMLYLLIQPSKVYKNFIYRKRTKDQFARDDPAFLVLLALSLLFSSIFY-------AYALGLEKIG----FFTFFLWSVFVDCIGVGVVIATVLWWVSNRFL-RK------VRDQDVEWGYCFDVHLNAFFPMLILLHVIVPILYPTLIDSPAFLSILLGNTFWFLAACYYVYITFLGYTALPILHKTQYFLYPISFIFMFFVATLTGGWNISRTALNFYHS
P87155_SCHPO/1-232 MSRSFRNGFRLLKL-SQMDFERAWWDMANLFRAPRRVYRSITLRKQNINRYGREDFSFIVLFSCMIVISALLW-------ALFYMNTPKG----YVTTITFMLFVDFGAVGVIMATMYYFIAKRFLMKSNDTILSSTDYQLEWNYCFDVHCNSFFPSFVLLYVIQLFLLP-VITRDNFISLFMGNTLYLVALCYYSYLTFIGYQILPFLKNTHALLLPIPMFFIMWALSL-LGFNVPKHVVDVYFG
Q9SKL4_ARATH/18-235 NPMFLQYFRRIVKW-QQMDVEYTFWQMLNLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLVVATVAY-------CVTYDHSSSH----AVVVVVSVLFTHFLITGAVIATCCWFLTNSYL-REETPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSP-LLIAHGFIPLLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILI---------L-----S