EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05198 alignment
(30 sequences with 76 aa)


IF3C_PORPU/13-88 RDLPQINDRIKFPKVRVIDDEGEQLGIFAPEAAIQLATKQGLDLVLVSDKSDPPVCRILDYGKYKFTQEKRAREAK
IF3_SYNY3/9-84 RDLPQINERIRFPEIRVIDSDGAQLGIITPNEAMEIADERGLDLVLVSETADPPVCRIMDYGKYKFEQEKKAREAK
IF3C_GALSU/13-88 KNKFIINNKISFPIVRIIDENNYQLGIYKIEDALKLAEEKNLDLVLINDKTEPPVVRIIDYGKFKFAQEKKSREAK
IF3C_CYACA/14-89 ESHILINENINFPCVRVVDVTGKQLGILDTRQAVEYAKNQGVDLVLVNEISDPPVCKLIDYGKHKFIVEKRVKEGR
IF3_BORBU/17-91 DKELKINYRIKAREVRVIFENGTQ-EVLSIEDAIKKAKEAGLDLVEVSPNVSPPVCKIIDYGKYKFHQEKRQKEQK
IF3_TREPA/10-85 NKSLRINGSIRVREVRLVDAVGQQCGVVPTPEALRMARDINLDLVEVAPQASPPVCKILDYGKYRFEMGKKLRDSK
IF3_STRCO/2-77 SAEPRINDRIRVPEVRLVGPSGEQVGIVPLAKALELAQEYDLDLVEVAANARPPVCKLMDYGKFKYESAMKAREAR
IF3_CHLMU/2-77 ALNLKINRQIRAPRVRVIGSSGEQLGILSIKEALDLAREADLDLVEVASNSEPPVCKIMDYGKYRYDVTKKEKDSK
IF3_MYXXA/11-86 SRDQRTNRRIRAREVRVVGSDGSQLGVMPLEAALDRARTEGLDLVEISPMASPPVCKIMDYGKFKYEEKKKASEAK
IF3_CLOAB/7-82 NKNFIVNEEIRQKEVRVIGDDGSQLGVIPTSEALKLAEEKELDLVAMSPNAVPPVCKIMDFGKFVYEQTKKEKENK
IF3_SALTY/10-85 ARPNRINSEIRAQEVRLTGLEGEQLGIVSLREALEKAEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQK
IF3_PSESM/14-89 APKAPINENISAREVRLIGADGEQIGIVSIDEALRIAEEAKLDLVEISADAVPPVCRVMDYGKSIFEKKKQVAAAK
IF3_RHILO/12-87 KDGPRSNRDIRVPRVQLIDAEGQNRGDVSINDALLLAEEAGLDLVEISPNAVPPVVKILDLGKLKYANQKKAAEAR
IF3_CAUCR/7-82 KDGPRINDEIRVPRVLLIDQHGEKQGEMPTASAMEAAEEAGLDLVEIVPNANPPVCKILDYGKFKFQEQKKKNEAR
IF3_AQUAE/4-79 LKEYRVNRQIRAKECRLIDENGQQIGIVPIEEALKIAEEKGLDLVEIAPQAKPPVCKIMDYGKFKYELKKKEREAR
IF3_RICPR/16-91 NNLPKANREIKAKEVRLVDENSEMYGVVNIREALDMAERAGLDLVEISPNAVPPVCKILDFGKFKYESKKRLHEAR
IF3_RHOSH/13-88 ETGPRVNERIRCPEVRLIGANGENIGVVTPSRAMMMAEEAGLDLVEISPNAEPPVCKIMDFGKFKYEQQKREAEAR
IF3_BACST/1-76 SKDFIINEQIRAREVRLIDQNGDQLGIKSKQEALEIAARRNLDLVLVAPNAKPPVCRIMDYGKFRFEQQKKEKEAR
IF3_LISMO/2-77 SKDMLVNDGIRAREVRLIDQDGEQLGVKSKIDALQIAEKANLDLVLVAPTAKPPVARIMDYGKFRFEQQKKDKEAR
IF3_STAAW/6-81 KDQTQINDKIRAKELRLIGQDGEQIGVKSKREALEMAERVDLDLVVVAPNAKPPVARIMDYGKFKFEQQKKEKEMK
IF3_THET2/1-76 MKEYLTNERIRAKQVRVVGPDGKQLGIMDTREALRLAQEMDLDLVLVGPNADPPVARIMDYSKWRYEQQMAEKEAR
IF3_DEIRA/5-80 AKDLKVNEQIRVRQVRLIGAEGEQIGIIDTREAMNMAREKSLDLVMVSPQAVPPVCRLLDYGRFRYEQQQNEKENR
IF3_STRPY/6-81 KKDLFINDEIRVREVRLVGLEGEQLGIKPLSEAQSLADASNVDLVLIQPQAVPPVAKLMDYGKFKFEYQKKQKEQR
IF3_CAMJE/4-79 EKEVLLNEEIRADEIRCVGDDGKVYGIISSDEALEIANRLGLDLVMIAADAKPPVCKIMDYGKFRYQQEKKQKEAK
IF3_HELPJ/3-78 RNEVLLNGDINFKEVRCVGDNGEVYGIISSKEALKIAQNLGLDLVLISASAKPPVCKVMDYNKFRYQNEKKIKEAK
IF3_MYCFE/11-85 TAEHMINENIPFQKVFVIGANGEKVGVLSTREAIEMAKEQRLDLVLISVQPK-PIARILDYGKFKYERKKKQKAAK
IF3_UREPA/9-84 KNQPLINDQIRFRTMVVIDDHGNNLGEMNRIDALNLAASKNLDLVVIAKKGNIPVTKILDYGKYKYEQKRRQKESR
IF3_MYCPN/32-107 EQKPLINDKIGFNEFILIDENGSNLGTVRRTDALKMAEEKQLDLVLIGSNPAKPIVKLLDFGRYTYDLKRKKRQSK
Q9H2K0_HUMAN/73-147 TAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMT-GLQILQERQRLREME
Q9CZD5_MOUSE/70-144 DAFSNTGRKISERIIRVLDEKGMDLGMMHRADVIRLMNKQDLRLVQRNTSSEPPEYQLMT-GEQIHQERLKLREQE