EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05168 alignment
(17 sequences with 134 aa)


Q97V55_SULSO/11-139 AFSYITQAEERLDLAKTEYERKKYNIVVRLCQEAVELSLKACLRLVNIEPPK.FHDVGPILKNNTDKFP--QWFKEKIDIFASYSRSLRKERELSMYGDEETNTP-.PELLYSAYDGQQSIKIAEEILEYAKKL
Q97YY9_SULSO/10-135 SKAFLNIAKKDNIRAKRALELKDYPECLFYSQQSVEKSVKAMLEVKLI-YKK.EHDIIADASNNLQDLG------NELDVVLNALDYLSGAWNISRYPFFNGNNITtPEEFVTEEMCKEGIKYSDEVIEIAENY
Y1304_METJA/11-142 AKLFIKRAEEDLEVAKVLLKTNHYPDSVYHSQQCVEKAVKAVLILNGI-IFR.RHVVSGVFRNVIYEMKIEDSWKEKLLNLIPKIESLEEHWVMPRYPEPYFGELWnPLEEYTKEDAEECLKDAENVLEVIKDF
Q9YE10_AERPE/10-132 AWLWLRAARRDLGRAEYSLKVGDRAAATFWSQQAAEKALKGLLLAFKGDYPK.THSIRRLLEDLGLDLG-------LSEGELEDAFELTQYYYLSRYPDVVEEL--.PDEVIGRRSAERAVNAARRIVEAAERA
Q97XN9_SULSO/3-126 YTDWMIQAEEDLDVARVLLEAGKYFAVTFYSQQAVEKALKSLLIHLGKDPGK.THSLTELASMIENE------GLKIPQNIMEDLMVISPHFIISRYPDAANGV--.PARQYTKNMAEDLYRRAKEVLGWVKGN
Q97VT0_SULSO/6-128 AQKWFRQALEDLATAKDTITTGHYYASAFWAEQAAEKALKALLIENGKIER-.THDLNQLLYVIKEEIGLP------VEEIRSEVNKLTLHYTISRYPDAANTI--.PYSLYTKEDAEELVKKAEKVIEWVRRN
O58422_PYRHO/5-125 ARLLWEQALEDLKTAEVLIEVKRYYASVFFSQQAAEKALKALYIEVKREFPPkTHSLLRLSNELGIK----------DEEIIDAVLDLNPEYIVTRYPDAANEV--.PAKIYNERIAVEHLEKAKKVIEFCRQK
Q9YCI5_AERPE/11-134 AVRWLRQAKHTLESIRVDYEGGFYSWACFKANQAAEYSIKAVLR--------.AAGLESFGHDLMALWRRARSLCQPLQEMEECIAVLNKLYLPPRYPDAWPGGAA.PFENYTRRDAEEALECASRVYRAVEEC
Q97XB1_SULSO/5-125 YYDWLRQAERNLKSAELNFENGIYEETCYEAQQVAEKSVKSLLSYFHK-EMR.GHSITFLLQFSSISIP---------DWILKCAQELDKNYIPSRYPDVYDQGA-.PLDYYSKDDATSCLECARKILAWVKEI
O58139_PYRHO/9-133 YERWIVEAKRTLSSAYSDLKEGYYEWASFKAQQAAELAVKAILRGLGF-API.GHSITRLLKDLSGSLN-----LDIPREILYFAMELDRNYIAPRYPDAYPEGS-.PFEYYSEDIAKELVKYAEKIIKFVEVV
P95880_SULSO/11-129 YRKLLTTAKDYLKASELSFEHNLYEASALNSEISAQLSL---IFKLGIEPPR.THGIRELLSLIYAKLG-DKRISDFTKENREKLIILENVRGKSQY---------.GLPPVSRDEAEIALSTAQEILKLVESL
Q97YR7_SULSO/3-117 MSFLLNNAKNFLHDARRDFEEGIWNLSVFHSEQALQLCVKYKLYIHLGDYPK.THDLKVLINSLGRF--------EKVEIDELMLDFLVQSYISSRY---------.LPYTFSKESAEKALNFVENMMRGLGCL
Q9UZ01_PYRAB/6-128 VEMLFHRSKDYMSLANVAFKEGKFDVAIFLAGQSLQLYLKATLVKYADLRLR.THSIRELLINIGKVFEMEEKVVEFIRSNRLLLRELEDAYIDARY---------.EPRKYSREDAEELIEFANKVMAFVEGL
Q97X68_SULSO/6-91 VRLFKRRALRFLDEAKRDLNEGYYDIGSFHVEQALQLYIKAVIFELFGKEYE.GHGIRELLGYLSKLLK-------------------ENEY--------------.-------------EELAKKVNERVSGM
O29662_ARCFU/7-123 AEKLRRRAMGFMDAAKERLKVGDYDLTCFMAEQAVQLYLKSVILELSGEVPR.THSIRQLLSILSKLLD------EQFDFDRKQLVFLEDAYIKARY---------.LGAGYEREDAEEAIKIAEEVISAVSRV
O28687_ARCFU/2-112 -EFLKNKALRFYSKALESFDKGEYDFTMFFVEQTVQLAIKYLIARRFGEIPK.THNLRILFEIAEQE--------EFYRNNLDVLREIELAYTASRY---------.FDVEYSKEIAEKSLSVAKKVIDLL---
O28659_ARCFU/6-128 MEILRERAFKFLKNAEQLIESGVYDIAAFNIQQFVELYLKYALFKKVGDYPK.TPSIKRLLREIGKASGKIDAVEEFMRENIDRISNVENAYITSRY---------.IPSEFERIEVENMLKLARKIRDLVDAL