EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05166 alignment
(5 sequences with 82 aa)


YCGL_ECOLI/13-94 FCVIYRSSKRDQTYLYVEKKDDFSRVPEELMKGFGQPQLAMILPLDGRKKLVNADIEKVKQALTEQGYYLQLPPPPEDLLKQ
Q9KQP1_VIBCH/12-92 LCSIYKSPKKEGTYLYIPKRDDFSQVPDTLKQMFGKPIFVMLVNLE-QRRLAQVNVEKVKQSMQEQGFFLQLPPPPENLLEQ
YCGL_HAEIN/21-102 LCAIYKSKKKLGSYLYVANREDFSSVPSVLLEHFGKPELVMMFNLLGRKALHNVDCNEVLETIKRQGFYLQIAKQDDGLFNS
Q9CNI7_PASMU/2-83 LCAIYKSTRKMGTYLYVAKRDQFDVVPEVLRNAFGPPVFVMMFNLAGEKALVNAEKAEVRKQIETQGFYLQMPKEDDWLFKL
Q9I449_PSEAE/4-85 ICSVYKSPRKSEMYLYVDKREALSRVPEALLVPFGAPQHVFDLLLTPERQLAREDVAKVLENIEKQGFHLQMPPGEEEYIEH