EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05133 alignment
(5 sequences with 486 aa)


SIZ_BPSPP/31-493 TTMIQKLIDEHNPEPLLKGVRYYMCENDIEKKR----RTYYDAAGQQLVDDTKTNNRTSHAWHKLFVDQKTQYLVGEPVTFTSDNKTLLEY----VNELAD-DDFDDILNETVKNMSNKGIEYWHPFVDEEGEFDYVIFPAEEMIVVYKDNTRRDILFALRYYSYKGIMGEETQKAELYTDTHVYYYEKIDGVYQMDYSYGEN--NPRPHMTKGGQAIGWGRVPIIPFKNNEEMVSDLKFYKDLIDNYDSITSSTMDSFSDFQQIVYVLKNY--DGENPKEFTANLRYHSVIKV---------SGDGGVDTLRAEIPVDSAAKELERIQDELYKSAQAVDNSPETIGGGATGPALENLYALLDLKANMAERKIRAGLRLFFWFFAEYLRNTGKG-DFNPDKELTMTFTRTRIQNDSEIVQSLVQGVTGGIMSKETAVARNPFVQDPEEELARIEEEMNQYAEMQGNLLDDEGGDDDLEEDDPNAGA
Q9G004_9CAUD/37-482 EEMIVRYIKQHLEKLPEISIGQEYYEQRPDIV-----KEPKPVDATGAVDPLKPDDRMITNFHANLVDQKVSYIVGKPIAFKHTDDEVVKR----IDEVLG-NRFDDKLHSVLTGASNKGIEWLHPYLDEEGEFKLFRVPAEQGIPIWTDKEHEELEAFIRMYKLENETK-----VEYWDKVTVNYYVYENGSLIPDYSNN------LENSKTHFSTGSWGKIPFIPFKNNDLEISDIFMYKTLIDAYNRRLSDLSNTFKDSNELTYVLTNY--DDQELPEFKRLLRYYGAIKV---------SDNGGVDTIQVEVPVENSKKYLDELYQKIMLFGQAVDFSSDKFGSAPSGVALEFLYTNLNLKADKLARKAKVAIQELLWFVFEHFDIKGEHKD------VDISFNYNKVANTELQV--QTAQQSMGIVSHETVLENHPFVEDLQAELERIEQEQMEYNKQLPNLDDGGADGAQQQERSNNKES
Q9K741_BACHD/14-451 SERLKDFLDRHAARLS-R---------YERLMNMYMGKHP--ILYEKEKELGKPNNRLVVNFAKYIVDMLNGYFIGIPVKTIHENKEVAAK----MKEIAKRNSQNDNNAELSKMCSIYGHAYEFLYQDENAHTRVTYVDPREAFVIYDNTVAQEPLYGVRVLK----DDKERPYGTIYSRYDERD---FFTSDDGELVIEE---KGQEH--------FFGDVPLIEYVENNERQSAFESVETLINAYNKAISEKANDVDYFADAYLVILGAELDEETIK----QIRDNRVINL-----KSGDGQKIVLEFLDKPNADTTQENLIERLERLIFQISMVANISDEKF-GTSSGIALKYKLQPMENIALMKERKFNNGMIRRFKMMFNIPTNFGVDPD--EYLNIEYVFTRNIPNNILEEA--ETAEKLAGITSRQTQLSVLSVVDNVQNELDRIQKEKEGEEINSFNRDMNSPFFGSGELDDGQEEE
Q9AZ65_9CAUD/19-448 VEVVTKFMEKHKLEVA-R---------YEYLKNMYLGIMA--IDDEPAKDSWKPDNRLAVNFTKYIVDTFTGYFNGIPVKKSHSDKEILTK----LQEFDNLNDMEDEESELAKMACIYGRAFEFLYQDEDTQTNVVYNSPENMFMVYDDTVKQEPLFAVRYGV----DEDKKLQGEVYTLL-ETI---KISGENDEISFGE----GTYN--------PYPDLPVVEFYFNEERMSIFESVISLVNAFNKAISEKANDVDYFSDQYLTFLGAAVEEEDLK----NIRSNRVINY----YADGEGKNVDVKFLEKPDSDSQTENLLDRLTKLIFQTTMVANISDESF-GSSSGVSLAYKLQAMSNLALSFQRKFQSSLNSRYKLFCELSTNVS-NKD--SWKDIEYTFTRNEPKDIKEQA--ETANILMGITSQETALSVISVIPDVQAEMEKIKKEEASTAIFDKDKQPSE------KGTDTVVSE
O34058_9CAUD/41-491 WELLKNFINHHKLRQAPR---------IQELLDYARGENHDVLQFGRRKDREMADKRAVHNYGRMISKFKTGYLAGNPIRVEYDDNDNNSQNDDTIKRIGRINDIDSHNRTLIRDLSQTGRAYEVIYRNEYDETRIKRLNPLETFVIYDNSLEDNSIAAVRYYN-RGTLQNAKDVVEIYT---------NEHIYTLDASDDFNEISVTTH--------AFGTVPITEFLNNVDGIGDYETELYLIDLYDSAESDTANHMSDMADAILAIYGDLALPKGMQ--ASDMKRTRLMQLKPPKSADGKEGTVKAEYLTKSYDVSGAEAYKTRLNRDIHIFTNIPDMSDTNFSGNTSGEALKYKLFGLDQDRVDTQSQFTQGLKRRYRLAARIGSLVNEFKD-FDESLLKITFTPNLPKSLNEQV--SILTGLGGQVSQETALSLSGLVESPNEELDKINKEV---SEIDFKGYSNDFNEHVGKYTDEVKET