EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05130 alignment
(4 sequences with 160 aa)


Q9KQ02_VIBCH/1-143 MA-MAALKDLVEFQLKNAQELVTVLEAEKVAITSRISV--DIESIAKQKLTLVNQLQQTDQRIAKHPHVASL--------------TEDTYLNELVSQIRSIIMDCQQANLINGDALARAQLSFNKLNNLMQQSHGKIGMTYSATGKTHTISTLGTNIKA
Q9HYP4_PSEAE/1-156 MPDSPTLLDLFAEDIGHANQLLQLVDEEFQALERRELP--VLQQLLGAKQPLMQQLERNGRARAEILREAGVSLDREGLARYARERADGAELLARGDELGELLERCQQANLRNGRIIRANQASTGSLLNILRGQDAPS--LYDSRGGTASSSRQRPLSQA
FLGN_ECOLI/1-138 MT---RLAEILDQMSAVLNDLKTVMDQEQQHLSMGQINGSQLQWITEQKSSLLATLDYLEQLRRKEPNT-----------------ANSVDISQRWQEITVKTQQLRQMNQHNGWLLEGQIERNQQALEMLKPHQEPT--LYGANGQTSTTHRGGKKISI
FLGN_BUCAI/1-135 MN---NLIDTIKKIENILYSLERILKQECHNLLKSKTSNEEILELIKRKKILFKKLIILSQDRLCLEKEYNIFPPY----------ESNNKLNNYWKKIINTCLILRKLNLKNKIIMNKKFYLNQRFLELSSSYKKSV--TYNLDG----------NLEI