EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05115 alignment
(6 sequences with 32 aa)


PETL_PINTH/16-46 TITIISYFGFLLASIIFTLVLFISSSK.IQLI
PETL_MARPO/1-31 MLTIISYFLFLIGALTLALVLFIGLNK.IQLI
PETL_ARATH/1-31 MPTITSYFGFLLAALTITSVLFIGLSK.IRLI
PETL_NEPOL/1-31 MFTVISYFGFLLVALAFTLVTYLGLRA.IQLI
PETL_CHLVU/1-31 MVTIFSYIALLLSALVITLTCYIGLLK.IKLI
PETL_CHLRE/12-43 MLTITSYVGLLIGALVFTLGIYLGLLKvVKLI