EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05082 alignment
(11 sequences with 67 aa)


YNI1_ANAVA/16-81 QQTIEGLKLQIKKLNSKAGQLKMDLHDLAEG-LPIDYQNLTALAAETYEIYRHLDELKSQLKSLEKN
Y1434_ANASP/5-70 ETSIEEIQTKIKRLNSKAGQMKMDLHDLAEG-LPTDYTQLMDVAAATYEIYRQLDELKQELKKLENA
O07359_SYNP8/11-76 AEEIDDLRKSIKRLNSVAGQMKMDLHDLAEG-LPTDYENLLDTAQKTYDIFRQLDTLKKQLKTWEEL
YFXX_AZOCA/1-66 MSDIETLKAEIKKLSAKSVNAKMNLHDLSED-LPTNWQSILEVAQETYNTFKTLEDARKKLKELEAG
Q9FA18_ACEDI/1-66 MTDIAELKAELKKLSARATKAKMDLHDLSED-LPVNWQAIPDIAAQAHRAFAELTEKRAALAAIEDA
Y4XE_RHISN/1-66 MTDLEELKQRVQKLQSRAATAKTQLHDLAEC-LPNYWTEIVAVAEKTFDAFAQLDAAKRELAASENS
Q98AS9_RHILO/25-90 MSDLALLQKKVRKLQSRAGAAKMELHDLAED-LPVNWTEIEAVAWKAFEVFAELDAAKEELAALENS
Q98AM9_RHILO/1-66 MSNLDEMAKKVRKLQLRAAIAKTNLRDLAEG-LPVKWIEIEEVAEKTHAAYAELDGARRELAKMKTL
YNI1_FRAAL/17-81 NLDAAAAQQRLRKLHSKATRLKLDLHDLAED-LPIGWEGLLDVARRTYDAYAEIALLEG-LAEKETS
Q9Z5Y1_FRASE/12-77 GTDEAALKARLRKMNSKASQLKLDLHDLSEE-LPLGWENILDLARRTYDAYAEIALLENELRAGAAG
Q44536_AZOVI/3-69 EDEIKALKKEVSQKKRIATEWASQIHDLVEDRLFNDYESLPELARQARQACVEWAEAKARLDATGAA