EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05045 alignment
(7 sequences with 514 aa)


Q985R7_RHILO/34-532 IIFVSNGEISQSSEASLRS--TVDETIIRENTGFDVGAYRDGLEFIGYDKLGDYDEILLLNHTFYGPVFPFSEMFSEMERR-ACDFWGISDHKEVSPNPF.TGAGVLPRHLNSHFIAVRKAMLESIAFRNYWERMPKITDYAESVLLHESRFTGFFENLGYKSETYLDSDKYNSAYPVMIDVDQIYNDRSPILKRRLFFNDPTFLDKNAV--DLPRALRVLKETSDYDLNLIWRNVLRSSDLRTLNTNAALMSVLPDKRIKGDGAAA-DYGKIAVCAHIYYTDMLDEILGLTGNIPVPYDFIATTNTPEKKAEIETA-LANRPGVKNVIVRVVEQNRGRDMSSLFISLRDLLVDDRYDLVCRLHTKKSPQVQSSMGNLFKRHMVDNLLNSRGYVHNVLDMFHDNPSVGLAIPPI-FHISYPTMGFSWFAN-.-KPKVEETARLLNINVKFD---ENTPVAAYGTMFWFRPRALRKMFEHKWKWEEFNAEPDHVDGGFAHALERLIAYAVQNAGY
Q985R6_RHILO/34-532 IVVVSNGNLSKLSEIAIKA--SCDQLLVRENVGFDVWGYKTGIDAVGFDALSEYDELILLNDTCYGPLFPFSEMFSEMERR-DCDFWGSAAHSKMTPNPF.TGTGHLPRHLTANFIAVREKMLKSRAFKTYWENLPAIKTYIDAIMLHESQFTKHFTDLGYSAEAYVDPDKYGSHYPAFINVDETIINRFPLLKRRPFFHDPTFLNAQGI--DLPRALRVLEETSDYDLNLIWRNVLRTSELRNLNTNAALMSVLPDERAKDDDAPS-DYGKIAVCAHIYYTDMLEEILALTGNIPVPYDFIATTDTPDKKAEIEAT-LAKRPGVKNVIVRVVEKNRGRDMSSLFISLRDLLVDDRYDLVCRLHTKKSPQVQASRSNLFKRHMLENLLNTRGYVHNVLDMFHDNPSVGLAVPPV-VHISYPTMGHAWFFN-.-RPKVEETARLLNIKVKFD---HDTPVAAYGTMFWFRPRALRKMFEHKWKWEDFNAEPNHVDGGLAHVLERLIAYAAQDAGY
Q985R5_RHILO/34-529 LLVVCNGPIDDEARSRLPD--ATDSFLIRENKGFDVWAYRTALEHIGWDELSQFDEILFFNHTFYGPIFPFSEMFSEMDQR-HCDFWGISAHKAIRPNPIdVRKSELPFHLNSHFIAVRRSLHQSKAFRDYWTRMVSINSYIESVAKHETVFTAHFQALGYTCSVLLDPERYRTPYPVFMEPDKTLEDRSPILKRRLFFHDTLSLERAAI--NLPRALEIIENQSDYDLSLIWKSVGRLGSPRTLNGNAALLSVLPDVQVGP--QRNWDDCRIAVLAHVYHLDMIDEILGYAENVPKGYDLIVTTDNADKQALIQQA-IAKATNASNAVVLVV-RNDGRDTSALLVGCRDYVLEDRYDLICRVHSKRSPQ-DGPRGELFKLHTFENLLHTPGYVSNLLELFANNPALGLVMPPL-VHIGYPTIGNSWAGN-.-KANVAKLARQLGLIVHLD---DSTPVAPYGGMYWFRPAALRKLFEERWNWNDFANMD-YRDGSLVHAIERIIAYVAIDAGY
O66255_ACTAC/34-530 IWFVSNSGLTVESRKKIQG--CTDHIMCRENIGFDVWGYKEAIEKIGFEKLAEYDEVILLNYTFFAPIFPFCELFEWSENQ-DIDFWGISDHAEIKPNPY.TGTGVLPKHIQSHFIAIRKGLLGSYEFQDYWKNMPMINSYTDSVLMHESKFTDYFLSKGYSYSVYISSDNFPVNYPTFLSIEETLKHRCPILKRRPFFHDPIYHDVECL--FLRRSIEYVENNTTYDTSLIFKNILRTTKPKDLATNLTLLKVFDSSKVE----KVRSDIKILVVAHIYYSDMLDEIISYTQNIPCSYDLLITTANEKSKLEIESNPILKMSGAKGINVKVVEQNRGRDMSSLFITCKQEIISERYDWVCRLHSKKSPQNSHNMSIHFKEMMYLNILKDKAYISKVINYLDKNKSIGFAMPSM-VHIGHPTLGHAWFTN-.-RDLAIKIAERVGIKLPFD---DISPFAAYGTMFWFRPEALKKLFEYNWKFEDFNKEPMHQDSSLAHILERLLVYAAHDAGY
Q9CIZ9_LACLA/34-519 VIFISNSELSEQYQQQLVD--FVDEFIQRENKGFDFAAWRDGMEQVGFDQLKMYDSVTLMNDTCFGPLYEMAPIYEKYEIQ-NIDFWGITNHRAYHES--.-KNHYFDEHIQSYYKVFNNNVINSQIFEDFWKNIVDYTNVQDVIDHYEIQSTKIFMDAGFKYESVLDTRALDAKN--LLHPDFSYYAPDVILKEKVPFIKVKAFQSIQSNGIAYYMLDYIDRNTDYPKSLVVDHLSTVGYP-DLN------FLLPSKMITPLSKTVL-HQTVAVHLHVYYPELLEEFLDAFKNFSFDYDLYLTTNTDEKEEIIKEM-L-KCKD-AKAKLVRT-PNHGRDIVPFL-ALKEEL--KKYDIVGHFHTKRSLEAAFFAGESWRTELISMLIEP---ADNIMAHFEQKQKLGIVIADIPSFFRFNKIVNADNENKqIAPIMNDIWKRMKMNKKVNFHDFNTFTMSYGTFFWAKIEVLEPLFNLEIMDREIPNEP-LPQNTILHAIERVLIYLAWDKEM
O82878_STRMU/34-515 VIFISNSQVADADVKMLREKHLIDDFIQRQNSGFDFAAWRDGMVFVGFDELVTYDSVTTMNDTCFGPLWEMYSIYQEFETKTTVDFWGLTNNRA------.--TKSFREHIQSYFISFKASVLRSTAFRDFWENIKEYQDVQKVIDQYETKVTTTLLDAGFQYDVVFDTTKEDASH--MLHADFSYYNPTAILNHRVPFIKVKAIDNNQH--ITPYLLNDIQKNSTYPIDLIVSHMSEINYP-DFS------YLLGHKYVKKRERVDLKNQKVAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIEEI-L-SANG-QEAQVFVT-GNIGRDVLPML-KLKNYL--SAYDFVGHFHTKKSKEADFWAGQSWREELIDMLVKP---ADNILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHL.IAPEMNTLWQKMGMTKKIDFNAFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEP-LPQNSILHAIERLLIYIAWNEHY
Q9A0G0_STRPY/34-514 IVFISNSKVSHEDLKRLKNHCLIDEFLQRKNKGFDFSAWHDGLIIMGFDKLEEFDSLTIMNDTCFGPIWEMAPYFENFEEKETVDFWGITNNRG------.--TKAFKEHVQSYFMTFKNQVIQNKVFQQFWQSIIEYENVQEVIQHYETQLTSILLNEGFSYQTVFDTRKAESSF--MPHPDFSYYNPTAILKHHVPFIKVKAIDANQH--IAPYLLNLIRETTNYPIDLIVSHMSQISLP-DT------KYLLSQKYLNCQRLAKQTCQKVAVHLHVFYVDLLDEFLTAFENWNFHYDLFITTDSDIKRKEIKEI-L-QRKG-KTADIRVT-GNRGRDIYPML-LLKDKL--SQYDYIGHFHTKKSKEADFWAGESWRKELIDMLVKP---ADSILSAFETDD-IGIIIADIPSFFRFNKIVNAWNEHL.IAQEMMSLWRKMDVKKQIDFQAMDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEP-LPQNSILHAIERLLVYIAWGDSY