EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05019 alignment
(5 sequences with 220 aa)


COQ4_SCHPO/48-267 PGHVPLSPLQRIFLVAGSAIMGLKAPWRGGDMISVLGDASGQPFFLHRLLNKMLVDKTGREILKDKPRMTSKSLNLPFLRTLPPNTLGKIYVDWIDKEHVGPDTRSPTRFVDDPEEAYVMQRYRESHDFYHAICNMPTNIEGELAIKWLEFVNMGLPVGALSALFGPLRLNCEQASRFRRVYIPWSIRNGLNAKTLINVYWEKELTNDIEDVRRRIRIEA
COQ4_YEAST/85-303 NGHVPLHRYEKLLLFAISGWNSFFHPEDGYNIVQ-LGEATALPVFLENLKQTMLSDSSGRRILKEQPNITTEILHMDKLAKLPHNTFGYVYYQWLKRENVSPDTRAPVKFIDDPMHAYIFKRYRQCHDFYHAITNMPIIIEGEITIKALEGANLGVPMAILGGILAPLRLKKVQRKRLYNIYLPWAVRTGLSCKPLINVYWEEMLEKDVTALRKELKITL
COQ4_CAEEL/8-226 ASHVPLAPLSRMLLGIGSAVTAISDP-KRGDMVAAMGETTAIGPVLENIRKRMESDVVGKRLLLEKPRISNGTIDRKWLRQLPDGTLGKLYSNFLDRLNTSPDARPTVKYIDNLEHLYVMQRYRETHDFTHIALEQKTNMLGEVTVKYFEGIQYGLPMCVTGGIFGGARLLTKNRQELVDRNLPWVVEQATNARFFMAFDWENHFEKQLSEVQKELNITP
COQ4_HUMAN/39-256 SHHLPTSPLQKALLAAGSAAMALYNP-YRHDMVAVLGETTGH-RTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQSLQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITA
COQ4_ARATH/5-220 RARVPLSRWQQAAVAMGSALGALVDP-RRADLIAALGETTGK-PAFEMVLERMKKSEEGRAILLERPRVVSEQVG--HAWDLPENTFGAAYAKFMGSRNFSPDDRPPVRFMETDELAYVATRAREVHDLWHTLFGLPTNLIGESSLKVIEFEQMYLPMCMLSVIGGTVRFNEKQRSMFLKHYLPWAVRAGRQCTDLMCVYYERHFSEDLEQVRRKWGIIP