EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04999 alignment
(7 sequences with 97 aa)


Q9F1N7_SHEVI/8-103 LIRIILADLWH-QKWILLLAMAVVANGITIVYTSYVSRKYISQWDQMWEERDRLDIEWRNLLLEEQSQSEHSRITRIASKQLDMSRPLPKEEIVVRI
Q9KPG0_VIBCH/9-105 LAKLIALDLLTVGRVPLLLLVLIFSCAMGVVFMTHHTRQAISAKDQAFMERERLDNEWRNLILEETALAEHSRVQQLARKDLEMKRPDSDKEVVINL
Q9AJG8_VIBPR/8-104 LAKLIGADLLTVGRIPMLLLILIFASAMGVVFMTHHTREAISEKDVAQAERERLDNEWRNLLLEETALAEHSRVQSVAKDELDMQRPDSEKEVIVTL
FTSL_ECOLI/24-120 LPGVIGDDLLRFGKLPLCLFICIILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKLQMQHVDPSQENIVVQ
Q9CPB3_PASMU/11-106 LQNIILDDLFSANKTIIALLFLIVMTALGTIWITHQTRILVAENGQLVLEHQALENEYLNLKLEEATQSDNTRIEAIAR-QLGMKRVEPEQEVLILE
FTSL_HAEIN/11-107 LQQILVEDLFSSNKLVVLLLIGILVSAMGTIWITHKTRQLISENGMLILQRQALENEYRNLQVQEATEGDSTRVESIAISTLKMKVVSSEQEVEIRE
Q9HVZ6_PSEAE/1-97 MSRLFVKRLPTGSFLMLLLYIGLLLSAIAVAYSTYWNRQLLNSLYSELSVRDKAQAEWGRLILEQSTWTAHSRIESLAVEQLRMRVPDPAEVRMVAP