EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04991 alignment
(11 sequences with 232 aa)


Q9CIZ2_LACLA/24-251 CRENGIEYTLAGGSLIGAIRHGGYIPWDDDIDIELTRPHYDHLISVLMDQLP-NEKYALLHYKVRETYLPFAKLYDTRTSFTSKIDNLNRGT.GVFLDIFPMDILPDNEEE.RQVFKKEFLKKAIQLTASNPHGLDFASSSKKIYFWGKLVLWMPQHIRFYGKYRILAEKLDEFMQKYRNSDNQLISYLYTGYK-KAIFPKEIWEEYEDVKFEGLTARKLKNHEEYLTRQYG
Q8E4B3_STRA3/24-249 ARDNKIEYSLGGGSLLGAMRHKGFIPWDDDIDLMLERSQYERLMKALADAN--NSDFKLLHHSVEKNLWPFAKLYHTKSMYLSKTDRIHPWT.GIFIDIFPLDRLPESAEE.RQRFFKKVHSAAANLMCTTYP--NFASGSRKLYANARLILGLPRFIAYHGQAKKRAEIVDQVMETYNNQEVPYMGYTDSRYRLKEYFPRKIFSEYEDVMFENIKTRKIKNEHAYLNQLYG
Q88YD0_LACPL/21-242 CEAENIDYFLIGGSLLGAIRHHGFIPWDDDIDIGMRRHDYQRFIAVANHHLDPNKFFLQTGASDPDYALSYMKLLDVNTYIEERNNVNNAFK.GVFVDIFPFDKIPDDE--.------ALRRSQMLHYKLADAAILLKLNYRFVKTPLRNLITKHTPQQLAEVNRYKLEREEYMRLYEQSDSRTYKNLASQYDYEKEIMTYQELTELTTVPFEDIQVKIPSAYDTILTRMYG
Q8CWR1_STRR6/24-245 CKKHDIPYFLSYGTMLGAIRHKGMIPWDDDIDISLYREDYERLLKIIEEENH-PRYKVLSYDTSSWYFHNFASILDTSTVIEDHVKYKRHDT.SLFIDVFPIDRFTDLS--.--IVDKSYKYVALRQLAYIKKS-RAVHGDSKLKDFLRLCSWY--ALRFVNPRYFYKKIDQLVKNAVTNTPQYEGGVGIGKEGMKEIFPVDTFKELILTEFEGRMLPVPKKYDQFLTQMYG
Q8DPI0_STRR6/24-243 CKKHNINYIINYGTLIGAVRHEGFIPWDDDIDLSMPREDYQRFINIFQKEKS--KYKLLSLETDKNYFNNFIKITDSTTKIIDTRNTKTYES.GIFIDIFPIDRFDDPK--.--VIDTCYKLESFKLLSFSKHK-NIVYKDSLLKDWIRTAFWL--LLRPVSPRYFANKIEKEIQKYSRENGQYMAFIPS-KFKEKEVFPSGTFDKTIDLPFENLSLPAPEKFDTILTQFYG
LICD_HAEIN/24-243 CERYKISYSLGGGTLIGAIRHKGFIPWDDDIDVYMHRDEYQRFVDVWFQETHEHYNMETAEDILAQYTGEMAKIFDCRTQITDAKGRKSP--.-MFMDIFIYDGVPNEP--.--KIIYPLMKKHRRIKLRFSS--CKKRWLRAKENTVQKAILN-KLSHFLFSKMQKNLAQFQIKYPIKQCDYIGLVLSDYGGWQKSYMPKEYFNHVIYKEFEGRQFQVMNGYHEHLTQYYG
Q87Q28_VIBPA/24-242 CERHDLEYSLAGGTLLGAIRHKGYIPWDDDIDIMMPREDYEYLLQNFAKEYP-DFTFFNLDTKHNPYPFLFSKLSLNDSVISNGRIKGVG--.-INIDIFPIDSLGKEK--.---GAAKLRFSLMKAINFFAR--IQRSRHDRANPIVNIAFRLFQKCLKLLPKKWFLSAIKGLCSTCSVNDDGYAVSIGSSYLAKEFTESSLYHDYTSCPFEDRQYKCIARYDDYLSMIYG
O07864_STRPN/20-249 CEENDIDFFLRGGSVLGAVKYDGFIPWDDDMDIAVPREAYDKLPSVFKDRIIAGKYQVLTYQYCDTLHGYFPRLFLLEDERKRLGLPRNTNLgLHLIDIIPLDGAPNHSVLrKIYFGKVYWYRFLASLGTTYVG--DHVDMHSTKQKLIIGFFKKLGFAKLFPQNSVYRRLDNLYKKYDWKKQKYAGTINASLFAKEVMPVEIWGEGVEKPFEDTFFKVPTGYDRYLKRLYG
Q8DPD7_STRR6/25-246 CKEHDLLCYLCGGGAIGALRNKGFIPWDDDLDFFMPRKDYEKLAELWPRYAD-ERYFLSKSHKDFVDRNLFITIRDKKTTCIKPYQQDLDLPhGLALDVLPLDYYPKNPAE.---RKKQVRWALIYSLFCAQT---IPEKHGDLMKWGSRILLG--LTPKSLRYRIWKKAEKEMTKYDLADCDGITELCSGPGYMRNKYPITSFEDNLFLPFEGTEMPIPIGYDVYLRTAFG
Q8R630_FUSNN/25-235 CNENKIRYWLDSGTLLGAVRHGGFIPWDDDIDIIIMQEDAKFLKENYKSEN-------FEIVNTDEEGINFYKVISKKEQVQVGDSIAELD-.--ID-IFLVTYYPDSLALkFWNSFFHLKKNRIDRFSFSLFFTNILINLKRKLEKTKLFNYKN---IEKKISYILDEAKKKNKAMPNIAYTPDCGFYLIIWREEEIFPLKK------MKFEGIEFSIPNNYDTYLKKMYY
Q8G7N9_BIFLO/105-313 CRDNNLPYWLDFGSLLGAVRHHGFIPWDDDTDLGMMREDIDRLQGIVQHDS----RYRLSLVYDAIAFCRQIRFMSSDTSNPCFVDIFIYD-.--YTDSTAIEVYDRRQ--.--HIRTELLDALRQSQFRAWHDLVYLSETSDGAAEIQQVFSR----YQREMEESGIVVSKENASGIMYGIDNVDNSSVRLYKLDDMFPTTCLT------FEDHEYQAPHTPMTVLTRNYG