EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04970 alignment
(9 sequences with 84 aa)


Q9FFE7_ARATH/102-175 HLFEYSASPSIFLAKR-GGTCTI-------ASSDP--CDEVISRAKFLLLQNGFGEYDLLDNNCEDFAIYCKTGLFVLSVATKF
LRAT_HUMAN/100-181 GVIVKVASIRVDTVEDFAYGANILVNHLDESLQKKALLNEEVARRAEKLLG--FTPYSLLWNNCEHFVTYCRYGTPISPQSDKF
HRSL2_HUMAN/52-133 SALTNKAIVKKELLSVVAGGDNYRVNNKHDDRYTPLPSNKIVKRAEELVGQ--ELPYSLTSDNCEHFVNHLRYGVSRSDQVTGA
HRSL3_HUMAN/52-133 SALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQ--EVLYKLTSENCEHFVNELRYGVARSDQVRDV
TIG3_HUMAN/52-133 SVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQ--KMKYSIVSRNCEHFVTQLRYGKSRCKQVEKA
HRSL1_MOUSE/58-139 SVFSTKALVKMQLLKDVVGNDTYRINNKYDTTYPPLPVEEVIQRSEFPIGQ--EVAYDLLVNNCEHFVTLLRYGEGVSEQANRA
HRLP5_MOUSE/163-244 SIFSNRAVVKYSRLEDVLHGCSWKINNKLDGTYLPLPVDKIMQRTKNMINK--IVQYSLIEGNCEHFVNDLRYGVPRSQQVEHA
Q9YLS4_9PICO/803-883 VDPEGNATNWFMKRKATVKKSKN-LDKWCFALSPRIDRTLICETANLMVGR--EVEYDIFVKNCETYARGIASGDYGTKEGEKW
POLG_EC22H/812-885 DDIFKTALTGKAKFTKTKLTSDWVIEEECELDYFR------IKYLESAVDS--EHIFS-VDKNCETIAKDI-FGTHTLSQHQAI