EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04968 alignment
(14 sequences with 66 aa)


Q9U4A7_TOXGO/125-189 GNYKCSNKGCNKEYSPNDNSPTACKFHPGQPVFRDCMKSWTCCQ-AKSYDWDEFMKIEPCQTGPHV
Q9N8L2_9TRYP/239-304 GKAKCRNFGCQQEFIVADNHPTACRYHSEGPVFWDTYRYWKCCPDKKCFDFDDFVKVPGCSVGPHL
Q9N8L2_9TRYP/108-173 GSIICTNYGCGQYFLPGENNDTACKHHKEPPVFHDIEKYWRCCTSRRARDWEEFKAIPACCTGPHS
Q9SE33_ARATH/155-219 QPQVCKNKGCGQTFKERDNHETACSHHPGPAVFHDRLRGWKCCD-VHVKEFDEFMEIPPCTKGWHS
Q9U4A7_TOXGO/1-65 MQKKCTRPGCGKSYKETENEEGSCVYHAAMPIFHDGVKRWPCCD-AEAWDWTDFMAIKGCSFGKHT
Q9U4A6_CAEEL/148-211 IGAPCRNNGCSTEFDGSKNKEN-CQHHPGAAIFHEGMKYWSCCN-KKTSNFGAFLEQVGCTSGEHK
Q9VCC0_DROME/136-200 VGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMKFWSCCQ-KRTSDFSQFMAQKGCTYGEHK
Q9D1P4_MOUSE/153-217 IGTSCKNGGCSKTYQGLQSLEEVCVYHSGVPIFHEGMKYWSCCR-RKTSDFNTFLAQEGCTRGKHV
ITBP2_MOUSE/146-210 TGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCG-IQTLDFGAFLAQPGCRVGRHD
Q9U4A6_CAEEL/5-69 SKLQCYHKGCGLLFDPKENDNEACTYHPGGPYFHDAYKIWTCCD-KKSTDFGTWMNYKGCTRGKHS
Q9U4A3_DROME/1-64 -MEQCYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCN-KKSVDFTEFLNIKGCTLAKHS
Q9D1P4_MOUSE/1-65 MALLCYNRGCGQRFDPEANSDDACTYHPGVPVFHDALKGWSCCK-RRTTDFSDFLSIVGCTKGRHN
ITBP2_MOUSE/1-65 MSLLCYNKGCGQHFDPNTNLPDSCRYHPGVPIFHDALKGWSCCR-KRTVDFSEFLNIKGCTVGLHC
Q9SE33_ARATH/8-72 KKLQCQRIGCNAMFTDDDNPQGSCQFHASGPFFHDGMKEWSCCK-QRSHDFSLFLEIPGCKTGKHT