EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04959 alignment
(2 sequences with 227 aa)


ARS2_HUMAN/636-857 MPNRCGIIHVRGPMPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRK-DPEQEVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQPPGPAQILPPGLTPGLPYPHQTPQGLMPYGQPRPPILGYGAGAVRPA-VPTGGPPYPHAPYGAGRGNYDAFRGQG---GYPGKPRNRMVRGD
ARS2_DROME/736-936 MPNRCGIIHARGP-PPVRVTNNDVQEYIKIYESKLQQFLTKTVPLSDEEIKNLGAKDA-ETEVEKFVQANTQELAKDKWLCPLSGKKFKGPEFIRKHIFNKHEEKVDEVRKEVQYFNNYLRDPKRPQLPE-HPGTSKRPESESARGGGGGYRPPMYPPFSAMPYG------FG-----PPMMGGGRGGRNFPPARRELP------LEHQRRLIG------YHDLDAP