EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04945 alignment
(26 sequences with 45 aa)


ATCU_RHILV/37-81 PICGMTVDPQAGKPSLGHGGRIYHFCSEHCRTKFAAAPEDYLTAK
Q98C24_RHILO/36-80 PVCGMTVDPAAGKPTSEHGGRLYHFCSERCRSKFQAEPEQYLTAT
Q98C24_RHILO/82-126 PVCGMSVDRATARHLVRHEGQGFYFCSAGCKAKFEAAPQTYLGDR
ATCU_RHILV/83-127 PVCGMSVDRSTARYFLKAEGEKFYFCSAACQAKFEADPAAYRDGQ
Q9WYF0_THEMA/6-50 PVCGMKIEKEEAAEKIEYMGKEYYFCSQECAEKFKDNPEQYAHQK
Q9HJ29_THEAC/4-45 PVCGMKVDKN-AKFKSTYNGKEYYFCSEHCKVEFDRNPIKYTR--
Q9F3R6_9BURK/1-40 ----MAVSTE-SKFRAEHDGKQYYFCSNSCHQKFLQEPAKYVGVK
Q46151_9GAMM/19-62 PVCGMDVSKD-TQYQTEYKGQWYGFCCEGCLIKFNKDQDMYLSGK
SILP_SALTY/45-88 -VCGMVILPDKAHSSIRYQDHQLYFCSASCESKFKAHPDHYFTED
Q978Z8_THEVO/1-40 ----MYVPET-SDLYVDKDGQRYYFCSKGCMEKFLSPEGESRSLK
Q9HJ30_THEAC/5-48 PVCGMYVPET-SDLYVDRDGTRYYFCSKGCMDKFLEPEKEGKNLA
Q9RBP2_9NOCA/410-452 -GSAFSLNDL-ADHSLTYNGRLYHFDSAISKWCFEQDPERYAGHQ
O87082_XANP2/408-446 --DRFHLKPE----QLVYKGRLYTFDSDVSKWIFELDPERYAGHT
O87798_PSEST/408-448 PGNKWNVKDY----QLEYEGRLYHFGSEADRWCFQIDPERYKNHT
O07068_BURCE/409-449 PGDAWAVKDY----QLEYNGRLYHFGSEPDRWCFEQEPERYAGHM
Q9EZP0_BURCE/408-448 PGNGWIVKDY----PLDYKGRTYHFNSEIDRWVFQQDPLRYRDHL
TMOA_PSEME/407-447 PGDDWNIEVF----SLEHNGRLYHFGSEVDRWVFQQDPVQYQNHM
Q97YT0_SULSO/200-240 PANGKYLRIY----LKEYKGKMYTFDSPACLWIFEQEPERYAGRR
O84961_9RALS/410-450 PDDPTQTCYR----ESSYHGMKFHFCSDGCKDIFDGEPEKYAQAW
Q9ZNP4_COMTE/413-453 PGDATKICYR----ESDYEGNKYHFCSDGCKHVFDDEPEKFVQSW
O32431_ACISP/420-459 -GDPTLFSYR----DSIYKDERYHTCSDGCHDIFEREPEKYIQAW
DMPN_PSESP/412-452 PDDPTKLSLR----SLVHEGERYQFCSDGCCDIFKNEPVKYIQAW
Q9KLU4_VIBCH/41-84 FTEGKPVKGA-AQFKTEYQGAEWLFASQQNLDAFLADPEKYAPQY
Q9PM17_CAMJE/410-454 PVSKTKVINTQAPFSYSYKGVTYYFSNQNNYEEFKKDPTKYVEEN
Q9ZC53_YERPE/411-455 PVDKSHLTNQKSEYKYSYGGKTYFFSSEANYNRFRDHPEQFVTPV
Q9CNI0_PASMU/418-462 PVDHSQLKNTRTEHKYSYEGKTYFFATEKNLHLFRDAPENYLNAE