EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04939 alignment
(6 sequences with 198 aa)


RRS1_CAEEL/4-174 KSTEVEKAIDPIIDLGNLLFIDRE-----------PIQGDASEGLEERARKNTQLLFNNIWQLEQKRVEEAI-----------IVTLPPATYRLPREKRLPEKKEPTKWEKYAAEKGIEKRKKD-KKVFDEATKEWKPTYGYRRGN-DDTKDWLIEIPDNA---EDPNKDFFAERREKKKERVAKNDMQRMKNLARQM
RRS1_HUMAN/22-197 QRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTP--EAE---LQALARDNTQLLINQLWQLPTERVEEAI-----------VARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKT-NLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPGNA----DPLEDQFAKRIQAKKERVAKNELNRLRNLARAH
Q8MR24_DROME/31-206 KPITVEKHLECRLDVGSLLITDPN------DFDDRELRDNKEEYLTALTRENTQLLVNAIWELPTERVDESI-----------VAKLPEPTTVLPRLRKPPGPRPLTKWEKFAKEKGISKKKKD-KKTYDETMDKWVPTYGFKRAEAEKAKDWVLEVPQNA----DPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAK
RRS1_SCHPO/1-164 MSAQIENSIPLDFDLGNMAAFDISPLDETKLSG-----SEKESFLFSLSRDNVQQLVNKMISLPKERTSDGV-----------LLQLPETVTPLPRAKPLPKPKPETKWQRFARIKGIAPKKREGRLVFDEASGEWVPKWGYKGKNKELETQWLVE------------------EGEKEKKLTSKQVRNTSKKIKRSR
RRS1_YEAST/9-203 LPVTVEKPIPVVYDLGNLAAFDSN---VLDKNDLDSSNARREEKIKSLTRDNVQLLINQLLSLPMKTTTESVGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAMTKWEKFAAKKGIKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLNRAERKRLVKKNEKQQRRNMKNAL
Q8LA50_ARATH/1-177 MDTEMETEQIYQVDVGNLLAFNPNH----RFSSAPSSRGELVKEILTEGTKLVQEIANKLFNFPSTETNDGP-----------IVQLPPPTTKLPREKHIPRPKPPTKWEEFALKKGIQKRKKE-KVVWDEQTNQFKRRHGYDRVN-DDNDVPIIEAKESD----EPGVDPFAKRLDDKKKRVGKQEKNRLQNLKAAE