EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04877 alignment
(2 sequences with 345 aa)


Q52481_PSESX/1-345 MQSLSLNSSTLQSPSMALVLIRPETETTGPSTSSRALQEVIAQLAQELTHNGQLDESSPLGKLLGKAMAASGKAGGGLEDIKAALDTLIHEKLGDNFGASADNASDTGQHDLMTQVLNGLAKSMLNDLLTKQDDGTRFSEDDMPMLKKIAEFMDDNPAQFPKPDSGSWVNELKEDNFLDGDETAQFRSALDIIGQQLGSQQNAAGGLAGDSSGGGLGSPVSNTENSPGSLGDPLIDANTGPASNSNSNGDVGQLIGELIDRGLQSVLAGGGLGTPVSTANTALVPGGEQPNQDLGQLLGGLLQKGLEATLQDAGQTGTGVQSSTAQVALLLVNMLLQSTKNQAAA
HRPZ_PSESY/1-341 MQSLSLNSSSLQTPAMALVLVRPEAETTG-STSSKALQEVVVKLAEELMRNGQLDDSSPLGKLLAKSMAADGKAGGGIEDVIAALDKLIHEKLGDNFGASADSASGTGQQDLMTQVLNGLAKSMLDDLLTKQDGGTSFSEDDMPMLNKIAQFMDDNPAQFPKPDSGSWVNELKEDNFLDGDETAAFRSALDIIGQQLGNQQSDAGSLAG--TGGGLGTPSSFSNNSS-VMGDPLIDANTGPGDSGNTRGEAGQLIGELIDRGLQSVLAGGGLGTPVNTPQTGTSANGGQSAQDLDQLLGGLLLKGLEATLKDAGQTGTDVQSSAAQIATLLVSTLLQGTRNQAAA