EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04827 alignment
(8 sequences with 112 aa)


Q9AY56_ORYSA/265-375 IEAIKGEAPQIQFIVNGTQYNTGYYL-ADGIYPEWAAFVKSIRSPQLEKHKLFAREQEGKRKDIERAFGVLQARFNIVHRPARSWSQKVLRKIMQACVILHNMIVEDEGEMA
Q9SH78_ARATH/72-176 DDIEQGNTPRVNFFVYQRQYNMAYYL-ADGIYPSYPTFVKSIRLPQSEPDKLFVQLQEGCRKDIERAFGVLHARFKII------WNIADLAIIMRSCIILHNMIVENERDTY
Q9AY86_ORYSA/44-154 TDILMGTSTRLRYTVNGIQYDLGYYL-ADGIYPEWATIVKSIRHPQLEKHKLFAQQQESARKDAECAFGLLGARFKVVATTTHLWEQSDISNIMTACIIMYNMIVEDEGHLD
Q9FYM5_ARATH/182-292 ANLAEGTAPPASYVINEKPYNMSYYL-ADGIYPKWSTLVQTIHDPRGPKKKLFAMKQEACRKDVERAFGVLQSRFAIVAGPSRLWNKTVLHDIMTSCIIMHNMIIEDERDID
Q9LDY0_ARATH/255-365 DDILQGRAPNVKYKVNGREYHLAYYL-TDGIYPKWATFIQSIRLPQNRKATLFATHQEADRKDVERAFGVLQARFHIIKNPALVWDKEKIGNIMKACIILHNMIVEDERDGY
Q9LHR9_ARATH/6-114 WTSRSSSESEIR--SQREDYNLAYYL-TDGIYPKWFTFIQSISIPQGDKASLFAITQEACRKDVERAFGVLQARFAIVKHPALFHDKVKIRNIMRAYIILHNMIVEDERDGY
Q9C845_ARATH/155-266 IGSIDCMHWEWKNCPTAWKGQYTRGSGKPTIVLEAATFIQSISILQGNKASLFATTQEACRKDVERAFGVLQARFAIIKHPALFHDKVKIGNIMRACIILHNMIVEDKRDGY
Q9ST09_BRACM/10-121 VRVVHNSLFLVLNVLNLQVWVKTDHLREKKERNGTATFIQSIQIPQGPKAVLFAQCQEAARKDVERAFGVLQARFAIVKNPALFWDKVKIGNIMRVCIILHNMIVEDERDGY