EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04826 alignment
(7 sequences with 264 aa)


Q9H969_HUMAN/289-552 EKYGPNPKACHCKSRGFSLEPKEFDKLVALLKLTKDPFIHEIATMIMGVSPAYPFTQDIIHDVGITVMIENLVNNPNVKEHPGALSMVDDSSESSEEPKSGESYIHQVCKGIISCPLNSPVQLAGLKLLGHLSIKFEDHYVITSYIPDFLTLLNKGSVKTKFYVLKVFSCLSKNHANTRELISAKVLSSLVAPFNKNESKANILNIIEIFENINFQFKTKAKLFTKEKFTKSELISIFQEAKQFGQKLQDLAEHSDPEVRDKVI
Q9BE11_MACFA/302-544 REVNGIKPFACPCKMECYMDSEEFEKLVNLLKSTTDPLIHKIARIAMGVHNVHPFAQEFINEVGVVTLIESLLSFPSPEMRKKTVITLNPPSGD-ERQRKIELHVKHMCKETVSFPLNSPGQQSGLKILGQLTTDFVHHYIVANYFSELFHLLSSGNCKTRNLVLKLLLNMSENPTAARDMINMKALAALKLIFNQKEAKANLVSGVAIFINIKEHIR------------KGSIVVVDHLSY---NTLMAIFR----EVKG-II
Q9BTM6_HUMAN/40-302 IRSSKSAEDLTDGSYDDVLNAEQLQKLLYLLESTEDPVIIERALITLGNNAAFSVNQAIIRELGGIPIVANKINHSNQSIKEKALNALNNLSVNVENQIKIKIYISQVCEDVFSGSLNSAVQLAGLTLLTNMTVTNDHQHMLHSYITDLFQVLLTGNGNTKVQVLKLLLNLSENPAMTEGLLRAQVDSSFLSLYDSHVAKEILLRVLTLFQNIKNCLKIEGHLAVQPTFTEGSLFFLLH-GEECAQKIRALVDHHDAEVKEKVV
Q9D0L7_MOUSE/38-300 LRPSRSAEDLTDGSYDDILNAEQLKKLLYLLESTDDPVITEKALVTLGNNAAFSTNQAIIRELGGIPIVGNKINSLNQSIKEKALNALNNLSVNVENQTKIKIYVPQVCEDVFADPLNSAVQLAGLRLLTNMTVTNDYQHLLSGSVAGLFHLLLLGNGSTKVQVLKLLLNLSENPAMTEGLLSVQVDSSFLSLYDGQVANEILLRALTLFQNINNCLKVEGRLANQIPFAKGSLFFLLY-GEECAQKMRALACHHDVDVKEKAL
Q9UH62_HUMAN/100-363 RARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVG
Q9CX83_MOUSE/187-450 AWPVRKGKFSFPYKIDDILSAPDLQKVLNILERTNDPFTQEVALVTLGNNAAYSFNQNAIRELGGVPIIAKLIKTRDPIIREKTYNALNNLSVNSENQGKIKTYISQVCDDTMVCRLDSAVQMAGLRLLTNMTVTNHYQHLLSYSFPDFFALLFLGNHFTKIQTMKLIINFTENPAMTRELVSCKVPSELISLFNKEWDREILLNILTLFENINDNIKSEGLASSRKEFSRSSLFFLFKESGVCVKKIKALASHKDLVVKVKVL
Q9CXI9_MOUSE/517-778 KRTIPMHKRPFPYEIDEILGVRDLRKVLALLQKSDDPFIQQVALLTLSNNANYSCNQETIRKLGGLPIIANMINKTDPHIKEKALMAMNNLSENYENQGRLQVYMNKVMDDIMASNLNSAVQVVGLKFLTNMTITNDYQHLLVNSIANFFRLLSQGGGKIKVEILKILSNFAENPDMLKKLLGTQVPSSFSSLYNSYVESEILINALTLFEIIFDNLRAE--VFNYREFNKGSLFYLCTTSGVCVKKIRALANHHDLLVKVKVI