EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04823 alignment
(7 sequences with 96 aa)


UL49_BHV1C/133-228 PRAPPGANAVASGRPLAFSAAPKTPKAPWCGPTHAYNRTIFCEAVALVAAEYARQAAASVWDSDPPKSNERLDRMLKSAAIRILVCEGSGLLAAAN
Q9E206_9ALPH/144-239 KRAPPGAGAIASGRPLSFSTAPKNTTSAWCGPTPAYNKRVFCEAIRRIAAAQAQRAAEAAWSSNPPRNNAELDRLLAGTVVRITVHEGLNLIQVAN
UL49_HHV11/163-256 TRSKTPAQGLA--RKLHFSTAPPNPDAPWTPRVAGFNKRVFCAAVGRLAAMHARMAAVQLWDMSRPRTDEDLNELLGITTIRVTVCEGKNLLQRAN
Q69318_9ALPH/80-174 PRTKPGVRAVQSNK-FAFSTAPSSASSTWRSNTVAFNQRMFCGAVATVAQYHAYQGALALWRQDPPRTNEELDAFLSRAVIKITIQEGPNLMGEAE
O89247_9ALPH/78-172 VRAKPGARAIEKGK-FAFSTTPASATSTWRSNTLVYNERIFCGAVAAVAQYHAYRGALSLWRRNAPRTNAELEEFLARAIIKITIQEGANLLDEAE
Q9DHC2_9ALPH/120-214 QRARPGVRAVQKNK-FMFSSAPTSRTSHWKSNTVAFNQHVFCCAVAAVARYHAFRGALALWNKEPPRTDEQLEDFLVRAVVKVTVREGPYLLEEAE
O56868_9ALPH/110-205 NHCAGLMRRLTISKGFGPSATPSGDEDPWHTSTIPANRSAFVQAVSVTAMAQAELAAREVWDVTKPRTNRELRDMVRELEITIIINPGESLWSVAT