EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04808 alignment
(3 sequences with 209 aa)


Q9DJS8_9CLOS/1-209 MNDTSGQTFVSVNLSDESNTASTRVENVKSEADRLEFLRKMNPLIIDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDPVKYLNKRKARAFSNAEMFAIELVLYTKEKQLAVDLAAEREKTRLARRHPMRSPEETPEHYKFGMTASAMLPELNAVGVGDNEDTSSEYPVSLSVSGGVLREHHFI
Q66245_9CLOS/1-209 MDNTSGQTFVSVNLSDESNTATTDVEPVSSEADRLDFLQKMNPIIIDALIRKNSYQGARFRARIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDPVKYLNKRKARAFSNAEIFAIDLVMYTKERQLAIDLAAEREKTRLARRHPMRSPEETPEYYKFGRTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI
Q66258_9CLOS/1-209 MDNPSGQTFISVNLSDESNTASTETKAVSSEADRLEFLRKMNPFIIDALIRKNSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDPVKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEHYKFGMTAKAMLPNINAVDVGDNEDTSSEYPVSLSVSGGVLREHHLI