EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04741 alignment
(3 sequences with 147 aa)


P97075_9ENTR/1-147 MKKFYSCLPVFLLIGCAQVPPPSSGSKPVQQPEVQKEQQANADSIDKCMSLPYVPSDLTENKTLSNQKSENSTSKNNTISSSVFCEKYRQTKEQAFTFFQEHPQYMRSKEDEEQLMTEFKKVLLESGSNNLSIYQTLLTAHKRLQAL
P97079_9ENTR/1-147 MNKFYSCLPIFLLVGCAQVSSPSSGSKPAQQTDAQKEQQASAKSIDECMSLPYVPSDLAKNKTLSNQNADNSASKNNTISSSIFCEKYKQTKEQAFTFFQEYPQYMRSKEDEEQLMAEFKKVLLESGSKNLSIYQTLLAAHKRLQAL
INVH_SALCH/1-147 MKKFYSCLPVFLLIGCAQVPLPSSVSKPVQQPGAQEEQLANANSIDECQSLPYVPSDLAKNKSLSNQNADNSASKNSAISSSIFCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKNLSIYQTLLSAHERLQAL