EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04737 alignment
(9 sequences with 176 aa)


EPIB_STAEP/7-161 PSNIY---------MVRTPIFSIELYNQFLKSD-------NIDYDLILQNDIFKESIMTTTYNLYQSIGKIDWE-----KDNKKTRNVKESLLKYLIRMSTRSTPYGMLSGVALGEFSENNNIKIKDSSFHKKDVKIDGQWLYKLVHYLESDYTYYKDSFVIWNQQNYIYNNRLYL
Q9FDU8_STRPY/1-147 MYKVF------PTGMIRIPLQKQEFY--------------NKDYEDLINDKVFMEQLLVASPSLYDSVIDFDK------CNEKKKQNVKVSLNSYSKRAAFRTTPFGIFTAINTVDLTKGTTSNVQKVSF-IKKAVPDYSWIYSLVKSYEI--SNLEKLSLKINTAAFTQGDRYVL
SPAB_BACSU/7-161 PTDYY---------MIRVPLVHQDLKNENSQDI-------DQLLHDLCNDSLFREQILVSSRTLYETIHTFLQA--PDKLKGKKKRNFQQAILKYATRRATRTTPFGLFSSVGIGSFSDKNHLSFNQHSF-YKKARVDLEWLYQLIRKLEN--EYTDRLSFTLNSACYIKGDRAYL
NISB_LACLA/8-157 AQP-F---------LVRNTILCPNDKRSFTEYT--------QVIETVSKNKVFLEQLLLANPKLYDVMQKYNAG----LLKKKRVKKLFESIYKYYKRSYLRSTPFGLFSETSIGVFSKSSQYKLMGKT--TKGIRLDTQWLIRLVHKMEV--DFSKKLSFTRNNANYKFGDRVFQ
O68588_STRMU/6-157 FQDYF---------MYRKPLGNFSNFFSITDTM--------DPIELLHSDPIFAEGVYLASSSLRAAINKLKNH----TASTKDKKNARETIFQYYARYNTRSTPFGLFSSIGVGAFSAYLKK--EKSRY-EKSINIDLFWAYKVADKLESMPEILNTLKVVANNALQKSDNFWLL
O54222_STAEP/3-162 LFKWY---------MIREPILEINKLEDIQERRDNNEDKYLNKLIDFIFDNELALPLYHANSNLFNMINNYKRK----ELSKKKKKNLILSLYNYITRMIFRATPFGFMSSINIGSIKPNEMTVWNNDTQ-KYNLDLDNRVLYPLLKNLNK--DIKNKIYLRKNYYIYKDYTHYYI
Q54123_STAEP/3-160 LFDWY---------MVREPILNINDLKIIKKNNLNDDEYLNMLITFIF-DKGLDVCLCHANIELFSIIKNYQNI----NLSKKKKKNLSLSLYNYITRMILRSTPFGFMSSINIKALDTTNPI-WNNYAK-KYNLEIDSRLLYPLINKLNI--VVKNELYLKKNSNVYEDTTHFYI
Q9RK93_STRCO/10-174 AAAVFEVREPVLVRMASRPRGAAPATVDAAEPV--------SGARQLAADPLLGQAVRVASGSLAHSLARLTTDEGASALGRKRTLSAARTLTRYARRAGARPTPFGLFAGVGTARFGSVAKA--GPGTG-EVAVRLDGAWLRRRVLAWLEEPSVRRRVDVVLNDLCFVRDGRLYL
Q9KYL1_STRCO/6-176 DCPLYRCADTALVRAARSARLPLPAWPDLTDDTPDCEVRWQTWLRDVWSLSEAADSIEQASPLLAQQVQALCSV---ASPETRQLRRAVVSVMRYLLRMTGRATPNGLFAGIAPASFGERPGWSWGE--WHRPVIRADGDWIADLVARLEADPELLRHLHVMANNTILIRGDRLIM