EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04736 alignment
(2 sequences with 62 aa)


ECLH_DROME/35-96 RFDSMGGIDFVQVCLNNCVQCKTMLGDYFQGQTCALSCLKFKGKAIPDCEDIASIAPFLNAL
ECLH_BOMMO/27-88 SPAIASSYDAMEICIENCAQCKKMFGPWFEGSLCAESCIKARGKDIPECESFASISPFLNKL