EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04729 alignment
(7 sequences with 162 aa)


ASF1_YEAST/1-155 MSIVSLLGIKVL-NNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPA.SELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPA.....KVQVDHIVRNILAEKPRVTRFNIVWDN
CIA1_SCHPO/1-161 MSIVNILSVNVL-NNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQSYDQILDTLLVGPIPIGINKFVFEADPPNIDLLPQlSDVLGVTVILLSCAYEDNEFVRVGYYVNNEMEGLNLQEMDDAeikkvKVDISKVWRSILAEKPRVTRFNIQWDN
Q9DAP7_MOUSE/1-155 MAKVSVLNVAVL-ENPSPFHSPFRFEISFECSEALSDDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPE.TDAVGVTVVLITCTYHGQEFIRVGYYVNNEYPDPELRENPPP.....KPDFSQLQRNILASNPRVTRFHINWDN
Q9V464_DROME/1-155 MAKVHITNVVVL-DNPSSFFNPFQFELTFECIEELKEDLEWKMIYVGSAESEEHDQVLDTIYVGPVPEGRHIFVFQADPPDVSKIPE.PDAVGVTIVLLTCSYRGQEFVRVGYYVNNDYADPEMRENPPT.....KPLFEKLTRNILASKPRVTRFKINWDY
Q9C9M6_ARATH/1-155 MSAIKITNVAVL-HNPAPFVSPFQFEISYECLNSLKDDLEWKLIYVGSAEDETYDQLLESVLVGPVNVGNYRFVFQADPPDPSKIQE.EDIIGVTVLLLTCSYMGQEFLRVGYYVNNDYEDEQLKEEPPT.....KVLIDKVQRNILSDKPRVTKFPIDFHP
Q9BJ46_LEIMA/3-158 DPVLQLLEIELLGANPDAYTNQFQWRMRVEATASLPQTVSVSFVWVGSASSSQHDQVLDDFEVGPLEKGITEFTLECDAPQMELVPV.EDVVGVTILLISFQYRGQEFLRVGYYTQVAYFDAQLNRNPPP.....LPQRELLGRFVAMPQPAVTVNPIDWGQ
Q9N927_9TRYP/4-159 QPIVQLLEIELIGDNPSSYTQPMHWRMRLEALEALDDTISIAFVWVGSAASPNHDQVLDSFDVGPLAQGVTEFTMECDPPQVELVPT.QEVLGVTILVISFQYREQEFLRVGYYTQVAYFDGRMNNCPPP.....VPQVELMGRFIAMPRPTVTVTPIAWNG