EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04719 alignment
(10 sequences with 100 aa)


TAF11_DROME/89-177 MQVLVSNFTEEQLDRYEMYRRSAFPKAAVKRLMQT---ITG-CSVSQNVVIAMSGIAKVFVGEVVEEALDVME.-AQGESG-----ALQPKFIREAVRRL
Q99JX1_MOUSE/106-194 MQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQS---ITG-TSVSQNVVIAMSGISKVFVGEVVEEALDVCE.-KWGETP-----PLQPKHMREAVRRL
Q21417_CAEEL/221-312 NQVLVANFSQEQIERYEVYRKSSFKKSTIKRLINE---FTGGIDLGKKVDIAVAGLAKVLVGEIVEEALDIRDlDEKEAKE-----PLQPHHIRQAYLRL
Q20563_CAEEL/236-327 TQVLLSNFSQEQLERYESYRRSSFQKSTIRRLISQ---YTGGVNVGQSVVIAIAGLAKVFVGEVVEEALDIRDiNEEEASN-----PLQPHHIRQAFLRL
Q9LNS8_ARATH/128-217 MQKILSQFTEEQMSRYESFRRSGFKKSDMEKLVQR---ITGGPKMDDTMNIVVRGIAKMFVGDLVETARVVMR.-ERKESG-----PIRPCHIRESYRRL
Q9M565_ARATH/105-194 MQTILSQFTEDQMSRYESFRRSALQRPQMKKLLIG---VTGSQKIGMPMIIVACGIAKMFVGELVETARVVMA.-ERKESG-----PIRPCHIRESYRRL
Q9US54_SCHPO/93-181 TKYLLESFDEEQMQRYEVFRRANLNKTNVKKLANQ---ILN-QSVTPNVAIVISGFSKVFVGEIVELARKIQD.-QWGDTG-----PLSPDHLREAYRLS
Q9C2R5_NEUCR/200-281 RGMLINAFSPDQFDRFENWRAANLSKAGVRRLINA---TIS-QSVTENVVIGMRAVAKVFIGDIIEGARRVQA.-EWIEKTG------------EKQTDL
Q9AW46_GUITH/30-124 DYEKINKLTRFQLMRYGIFRRSDLKKEKIKKIISQSNVVLKNITSMDPLIIAIKGLAKIYIGEKIEKAKQVM-.FEIEDTSRWMSSPIQNNHL---IKSL
TAF11_YEAST/124-213 FKLLVTNLDKDQTNRFEVFHRTSLNKTQVKKLAST---VAN-QTISENIRVFLQAVGKIYAGEIIELAMIVKNkWLTSQMC------IEFDKRTKIGYKL