EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04716 alignment
(5 sequences with 58 aa)


NUFM_ARATH/27-83 PNARAVLIDLYSKTLKEIQ-AVPEDEGYRKAVESFTRQRLNVCKEEEDWEMIEKRLGC
O94061_CANAL/37-94 PNPRPALVTLYNETLKTLKENFPADSVYRQSTEALTQNRLKIVESEEIVENIENQIGG
Q9VTB4_DROME/18-74 TNPHHTLSALYGKILRAVS-KMPQDASYRKYTEQLVKQRADSVAQHKDITALEKAVGC
NUFM_CAEEL/52-108 EHPHRALTVVYGRILRALE-QIPRDAAYRKYTEAVVKQRLALVQAENDIKKLEEKIGM
NUFM_MOUSE/17-73 DTPHERLTILYTKTLDILK-HFPKHAAYRKYTEQITNEKLDMVKAEPDVKKLEALLQG