EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04703 alignment
(5 sequences with 71 aa)


Q9EUH2_SALEN/1-70 MSESIITHIISIIRERQNAHDGAPVKTRDIADAAGLSIYQVRSYLEQLRAVGMLEKVNAGKGVPGLWRLL-
Q9ADX3_ECOLI/1-62 MKDNILTFLTEL---------KTPCRTTEIAIHFGLSAYQARYYLMNLEKEGKIKRSPVRRGASTLWEMNS
DAAF_ECOLI/11-72 RKNDILSYFGEI---------NAPCRTSEVAEHLGVSAYQARHYLQCLEKEGKIKRSPVRRGASTLWEISS
Q47204_ECOLI/1-61 MKEHILEYINS----------RGSCTTREIADATGISAYQARYYLMTLDREKKIRRTPLRQGARTLWGVLR
Q47193_ECOLI/5-65 MKNEILEFLNR----------HNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQRSPLRRGMATYWFLKG