EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04695 alignment
(9 sequences with 153 aa)


O60065_SCHPO/1-98 MREDLLRNSVEFLREKTVLDAPDVKKIEFLKSKGLTAEEIQEAFKLAKN-----------------------------------------------------PLFPSYPRFENTSNFVSR--DWRDWFIMGVISTGFAWSAYSLVKKYIAPMF
PEX14_YEAST/8-123 DRKALFDSAVSFLKDESIKDAPLLKKIEFLKSKGLTEKEIEIAMKEPKKD-----------------------------------GIVGDEVSKKIGSTENRASQDMYLYEAMPPTLPHR--DWKDYFVMATATAGLLYGAYEVTRRYVIPNI
Q9HG09_PICPA/4-126 IREEMVTSAVEFLKNPQIADSPLAKKIEFIESKGLNEAEVKEALLRSQGG-----------------------NGSSSVASQVSSYSPSASQSSVAPSPPPFPDHYRNAPP-----LPER--DWKDYFVMATATAGVSFGLYKVISNYVLPKL
PEX14_PICAN/9-120 SRAELVSSAVEFLLDQSIADSPLAKKVEFLESKGLTQQEIEEALQKARTG----------------------------------TVQASPSQQSVVPPRPPVPDYYPSAPP-----LPER--DWKDYFIMATATAGISYGVYQFVKRYVVPKI
Q9P5M0_NEUCR/3-129 IREDLVASAAQFLQDPSVAASPIEKRIAFLQAKNLTQEEVSAALARAESG------------------------GPPPPYAQSPAYAQSAGPVAAQGGSPQYYGYPPYAWPQSNTDGVRR--DWRDLFILATVVGGASYGLYNLGKRYVYPLI
PEX14_HUMAN/24-135 PREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQSGTA---------------------------------------ADEPSSLGPATQVVPVQPPHLISQPYSPAGS--RWRDYGALAIIMAGIAFGFHQLYKKYLLPLI
Q9VPB8_DROME/33-145 PRESLITTAVSFLQNTKVRHTTLIQKQQFLRSKGLTAHEIQLACERAGVF--------------------------------------TQDPNKPNPNPNTVISIGSQLHALQPQPTVLG--RIREIIHSAALFSGVVYAVYIFWKQYIAPYL
Q9NE79_LEIMA/204-356 DADTTVQSAIRFLQDPRVRCSPVESQIRFLKGKGVSDGQIKYALAKVGRTVTAEKIASVRAPLANAAPTGATATAYATPLSAQLKTARQNAPVAMTPGPQYTQMLFPHSPPPPQVERQTKTVDWRDVVIGAGAAMLAGFSAYKLFNRYSPYEF
Q93930_CAEEL/9-116 IRPDMVEAARKFMLTPKVKETPFEEQRQFLLGKGVSEAEILEARASIPPE---------------------------------------------QLRSQIGTENMIPIGGHPQMMIAPKQNGIVSFAQSAVVLGSISYAGYRFVRSYVLPRF