EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04689 alignment
(3 sequences with 71 aa)


S1FA_SPIOL/1-70 MAVNEVE-AKGLNPGLIVLLVIGGLLLTFLVGNFILYTYAQKNLPPKKKKPISKKKMKRERLKQGVAPPGE
S1FA2_ARATH/7-76 AGKAVVE-AKGLNPGLIVLLVIGGLLVTFLIANYVMYMYAQKNLPPRKKKPLSKKKLKREKLKQGVPVPGE
S1FA1_ORYSA/6-76 NNMIIEEVNKGLNPGTIVLLVVATLLILFFVGNYALYMYAQKTLPPRKKKPVSKKKLKREKLKQGVSAPGE