EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04664 alignment
(2 sequences with 215 aa)


OGFR_MOUSE/71-285 DLTDQDCNGDMCNLSFYKNEICFQPNGFLIEDILQNWKDNYDLLEENHSYIQWLFPLREPGVNWHAKPLTLKEVEAFKSSKEVRERLVRAYELMLGFYGIQLEDRNTGAVCRAQNFQPRFHNLNSHSHNNLRITRILKSLGELGLEHYQAPLVRFFLEETLVQHKLPSVRQSALDYFLFAVRCRHQRRELVHFAWEHFKPRREFVWGPRDKLRRF
OGFR_HUMAN/81-295 DLVERDCNGDTPNLSFYRNEIRFLPNGCFIEDILQNWTDNYDLLEDNHSYIQWLFPLREPGVNWHAKPLTLREVEVFKSSQEIQERLVRAYELMLGFYGIRLEDRGTGTVGRAQNYQKRFQNLNWRSHNNLRITRILKSLGELGLEHFQAPLVRFFLEETLVRRELPGVRQSALDYFMFAVRCRHQRRQLVHFAWEHFRPRCKFVWGPQDKLRRF