EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04657 alignment
(10 sequences with 145 aa)


Q9CJV1_PASMU/3-144 VFYTIIALVAGVALASQAAINSQLAKAMGNePLVATFISFGTGTFLLLVISLLKTDL-IGH-LSSATQHAWWK-YIGGALGALVVFTTILLSPKMGITNMLFFIIVGQLIAAMVIDHYGLIHMPVREVNLFKFIGIAIVGIGLII
Q98M54_RHILO/4-145 VVWSLLGILSGAFIAIQAPINSQLARGLGL.PVAAAAFSFLSGAIVLGIIAVTVVKL-QGISLDWKAPAPWLF-VAGGMLGGFYVTLSTVLTPRIGAAALMAFLVAGQLLAGMLIDRVGFLGVAVREISLGRVAGAVMLLAGALL
Q9CES9_LACLA/2-143 YIYLAFALVGGFLLANQNPINADLRKIVGS.PFLASGISNFVGSIFLGIITLVTSQTLFPS-FQFVGSHPAWI-WIGGVLGGIFLTSNVLLFPRLGAVQTVILPILGQILMGTLIDSFGWFHAMQLPMTLMRFLGIIITLAGVIV
Q99VZ6_STAAM/2-144 LLFYIIGVLVGMLIPIQTSVNSRLSLYTKS.PFYTSFISFSVGTICLIILNIIINPEVFTIHFYNNQSFN-YTWVVGGLLGVSFLTGNLLLLPKLGATLTVIATVAGQIIMGVIIDTFGLFGATIHDFNLIKAIGVLLLIVGIVI
Q9HYS5_PSEAE/4-144 YLMVLMAVSVGGMVVLQAGSNALLGRLLGH.PLSASLTSLGVSLGVVSLGLLLVRVPLPATA--SLGGAPWWS-WLGGLFGAAYLTVAILVAPRLGAATFIACVVAGQMLVSALCDQFGWAGFPVRRLSWEGYLGLALVVAGVLL
Q9RVB7_DEIRA/18-157 AGPLLLLIAAGALLPGQFAVNTALARQVGS.VVLAGTVSYGVGSLLLLLLLGLGRAT---PDWAAGRRAPAWA-WLGGVVGSAYVVGSVVLTRELGAGLATTLVIAAQLLTALLLDHFGWLGLTRRPLNRRRTAAALLALAGLAL
Q9HUZ5_PSEAE/6-145 WWLFVLPLLAGACLPLQAGINGQLAKQVSS.VLAAALISFFVGTLGLLALTLSQRE-FPGLA--ALRGLSWWH-WCGGFLGMFFIFIAAFAAPRIGALMFMVLVLAGQLGMAMSLDHFGWAGFREAPISALKLGGLALIGAGIWM
Q9RVB6_DEIRA/7-144 WLVLLGTLGAGLGLSAGGAFNLRLLRGLRV.PLAASLVNFLVGTTVLGVLWLLGVD-----GHRPDHWPPLWT-LLGGVLGAAYVTLNVTGAARYGVGVSTVAVTLGQMLGALLLGSRGWFGQTAQAPGAPAWLSAALLLGAVVL
YDCZ_ECOLI/4-143 SLTLAFLIAAGIGLVVQNTLMVRITQTSST.ILIAMLLNSLVGIVLFVSILWFKQG-MAGFG-ELVSSVRWWT-LIPGLLGSFFVFASISGYQNVGAATTIAVLVASQLIGGLMLDIFRSHGVPLRAL-FGPICGAILLVVGAWL
Q97DD1_CLOAB/1-138 MIGIISSIISGICMSLQGVFNTRLSEKIGL.WETNAWVQ---GTALLVTLVICFIY--GNGNLKMIGTANKLY-LTGGILGAIIIFTVMKGVSSLGPTCSISIILIAQLLSAAIIDFFGLFHTDRLTFDSTKIIGVVLMLAGIIC