EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04656 alignment
(5 sequences with 571 aa)


VE06_VARV/1-567 MDFIRRKYLIYTVENNIDFLKDDTLSKVNNFTLNHVLALKYLVSNFPQHVITKDVLANTNFFVFIHMVRCCKVYEAVLRHAFDAPTLYVKALTKNYLSFSNAIQSYKETVHKLTQDEKFLEVAEYMEELGELIGVNYDLVLNPLFHGGEPIKDMEIIFLKLFKKTDFKVVKKLSVIRLLIWAYLSKKDTGIEFADNDRQDIYTLFQHTGRIVHSNLTETFRDYIFPG-DKTSYWVWLNESIANDADIVLNRPAITMYDKILSYIYSEIKQGRVNKNMLKLVYIFEPEKDIRELLLEIIYDIPGDILSIIDAKNDDWKKYFISFYKANFINGNTFISDRTFNEDLFRVVVQIDPEYFDNER-IMSLFSTSAVEIKRFDELDINNSYISNIIYEVNDITLDTMDDMKKCQIFNEDTSYYVKEYNTYLFLNETDPMVIENGILKKLSSIKSK--SRRLNLFSKNILKYYLDGQLARLGLVLDDYKGDLLVKMINHLKFVEDVSAFVRFSTDKNPSVLPSLINTILASYNISIIVLFQKFLRDNLYHVEKFLDKSIHLTKTDKKYILQLIRHGRS
Q9Q8R4_9POXV/1-565 MDFIRRKYLIYTIDNRIDFLRDEMISKVSNFNLNNVLAIKYLVINFCKDVVSKDVLTNPNFFVFLHIVKCKDVYNELLCCVFDAPTLYIKALVKHYALFSDVIETYKKTVQELMFDDRFTEVARHATRFGDIIGVNYDLALNPLFHYGEPIKNMDIVYGKLFKKSDFKRVKKMEVFRLMIWAYLSKQDTGIEFSDNDSQDIYTLFQTSDNVIHSDMTEKFKEYIFGG-NRSSRWIWLNEPIANDADIYLDGFAVSMYDKVLSYVYSELKQGRVNKNMLKLVYIFETDEYIQSVLLQIIYDVPGDILSIIEAKDDAWKKYFIGLYKEHFIDGKTFNSTRTFNSDLFNVVAKISPSYFDPEK-VISAFDHPPDKVKFFDKMDINDTYISNIVYETKELNISTIEESQKCQIYNQETSYYIKEYNTYMYLHEEDPYVLHKGMFVKLSTVPQ---DKKFSLFSDHILKYYIDGKLARIGLVVTDYK-DVLVDILSHLKCVEDVTTFVRFSVCKNSSVISSVVRTILGNFNTSVIVLFQKFLRDNMYYVELFLDNTNHLTENDKKYLLNVIKHGRT
Q9DHS5_YLDV/1-567 MDYIRRKYLIYTIENKIDFLKDEVFNKVSNFSLNHVLALKYLIINFSNDVINKDVLNNPNFFVFLHMVKCNQVYDTVLNQSFDLPTLYVKSLIKNYSLFYNFIQTYKTLVQDLIFNKKFIEVVSYIDTFKDVIGVNYDLNLNPLFYNGEPIRNMEIIYDKLFKKTDFKAVEKLSVIRLLIWAYLSKQDTGLIFEDNDSQDIYTLLQKSGQIINSEMTEKFKEYIFPGNNKTSYWIWLKENIFNDNKIFKKYLSTTMYDKILSFIYLELKQGKVNKNMLKLVYTFEEDEYIKSVFLQIIYGVPGDILSIIDSYDEAWKKYFIGMYKDQFIDGNTFLSSRTFNDDLFKVVAKIDPEYFDINK-IISVFDHKPEQINFFNSIDINKTYISNIIYDLKDVNFSNINNLKSCQIYNDDTKYYIKEYNTYLYLNEDDPLILNNGILTKYSTIQP---NKRISLLSKNILKYYIDSNLANIGLVLCNYDGDIIVKIISHLKCIEDVTTFIRFATCKNDSILPSIIKTILANFNVSIIILFQKFLQENIYHVELFLDKSNHFTNNDKKYLLKLIKEGRS
Q98205_MCV1/1-565 MDFIRRKYLVHTIERNMDFLRAEVAEKVANFALNHVLALRYLVAQFPRAVLTKDVFANVNFHVFLHVVRCAQVYDAVLRSSFDATTLYVRALVRNYQAFADTVQTYRELCQTLLQDKRFLEVARAAPTLADVIGVNYDTSLNPLFLRGEPVRDMELIFTKLFRKTEFRPVKKLAVLRLLLWAYLCKQDTGLDFADNDAQDLYSLFQKTGPVVHSEMTERFKAFMFAG-EKTSYWVWLQEPVANDADVFKERPARGMYERLLSYLYSELKQGRVNKNMLKLVYIFDSDPSIRSLVLEIIYGVPGDILGVVDSEDETWKAYFVALYREHFVDGRTFTSTQSFFRDLFRVVARVDPEHFGAER-FAALFNAQPEARARFDDMDVNTTFVSRMVYQTPDLDLLALERNRMCQIYSEDTQYYVKEYNTFLFLHEDDPVVIDEGALVRLSSVPS---ERRRLLFSEHVLKYWLDGQLARLGLVLPSYD-DVVLRMVTHMKCLEDVTAFVDYATRRNASMVPAVTRGLLAHFHVPVLVLFQRFLREHLLRVREVLDRSEHLTEREKKYILQIITHGRS
V096_FOWPV/1-571 MDFIRRKYLIYTVENNINFFTQELADKISNFCLNHVVAINYIIKKYHKSVLTKDIFNNTNFYIFLHFIRDCETYDIVLKSSFDVTLLYLNQLVKNYTSFTDFIDIYKQQSNTLLDDKRFLFVTKLSPYFQDIISVNFSTELNPLFHLNEPIKDLEIIYSKLFKETRFIKVDRISVLRLLIWAYSLKMDTGMKFDDNDSHDLYTILQKTGPVVSSIMTETFKEFVFPKNSTTSYWLFMKERIYNDEKVYTNEPAITIYEKVLSYIYSEIKQARVNKNMLKVVYMLDSDSEIKKFMLELIYGIPGDILSIIDERDETWKSYFVDFYHDNFIDDKTFTSANRFYDDLFNVIAKIDPEKFDIRRDIESIFRTDATLVKRFDDMKINSTYVSQMIYQTQNVDLLALENKKLCQIYNKDTEYAIKEYNTYLYLNEDNPIVIYKGELKKLSDLDLNSPSIVFSLFSKSLLKYYLDSKLASLGLIIENYKDDIILKIITGSSCLQNFTSFIVYATCNDKSILKSVVRTIINHFKVAIIILFKQFLQENIYYVNEYLDNTKHLSKNDKKFILQIINGNYD