EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04632 alignment
(11 sequences with 121 aa)


YHCP_ECOLI/344-461 VKVESAERHHAMVNFWRTTLSCILGTLFWLWTGWTSGSGAMVMIAVVTSLAMRLPNPRMVAIDFIYGTLAALPLGLLYFLVIIPNTQQsMLLLCISLA---VLGFFLGIEVQKRRLGSMGA
FUSC_BURCE/228-346 RYEPRTNKTAATIAGIRTATVILALGWFWIETAWPSGVMLVLNAAATCALASSAPRPTAMAAQMGMGTALAVCTGFLLTFGIYPRIDG.FVLLCAALAPLLAIGIY-MSLKPKLAGYGGAI
Q9I570_PSEAE/395-513 SFVARANPVAALVAGARSALMIGLLGTFWIQTSWPHGGTFALTAVLISALSSTSPNPGRLSLQLTLGTLAGACTGLFVLLYLLPHVDG.FPMLLCCLLPVFAVGAL-LLWRPQWNGYGVGL
Q9HXC0_PSEAE/385-503 AFTAKANAVAAAVAGMRTGLMILLFGCFWIYSTWPSGGTFALNAVAVSALASAAPNPKKVAMQMAIGTMAAALLGFSEMFFVYPHIDG.FPLLCLVLAPVFALGAF-ISSRPQWAGYGLGL
Q98LS3_RHILO/365-483 ALVVHRDYPGASRNAVRAALATLLVAAFWLTTKWSEAAGTVILVAVVSSLFAARPDPVQVSWGFFKGTLLALPFAFLIGQIALPALPG.FGWFVLFVVPILVPTAL-GMANPRYVGIATAF
Q9I474_PSEAE/343-461 AIAWHRDIERGVLFGLRSALAFLCVAAFWLASAWPSGLGAVSITGVVLSLFASRDNPAQAGLNFLRGILLSIPLAGFVALFYLPGVDG.FPLLCLGLGVPLFFAAL-CVNRASLAGIASPF
Q9HYT9_PSEAE/341-459 TLSWHRDLQMALFYGTRSALALLGLSVYWIYTAWPAASGAMLLAAVVCSLFANRDNAVAIGLSFLRGIVYAIPAAMLVSQWLLPQWNG.FPLLCLAMGVPLFFATL-GMAVPVTAGTATSF
Q9I151_PSEAE/372-490 AQALHLDWALASMNAVRAFVALSCAAWLWITSAWNGALSSLLLVGVMCSLMATFPRPLLAAQNFLRGLLLAILISAALLFVLLPASAD.FEWLALWMALLLYVVAV-GLSSPLSAGIAMGI
Q9I4A6_PSEAE/360-478 PAAFHRHYREALRNGARAWLAMLVGGALWFLSGWDQGPTLLAVLGPYCTLLAASPFPAEGTRNFIRGTLYAIPAALLCKFLLLPLING.FPLLLLCLAFFWSFGIQ-ATTVPRRALQGIAY
Q48403_KLEOX/5-123 DTFSIAIPSSAARTALGAFVIILSGCLLWIYSAWPDGGTAVSILGVCCTLFGSFDTPAPHIVKYIIGSVWGVVISLIYSFALLPPLSD.FPVLVAVLAPVYLLAGS-LQARPPTTFMAMGI
YDHK_ECOLI/349-468 GLARHTDNAEAMWSGLRTFCTLMMIGAWSIASQWDAGANALTLAAISCVLYSAVAAPFKSLSLLMRTLVLLSLFSFVVKFGLMVQISD.LWQFLLFLFPLLATMQLLKLQMPKFAALWGQL