EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04631 alignment
(8 sequences with 377 aa)


Q9QAB4_9NUCL/6-379 IVITILVLLGIYIFTKPLLDTIYVIQTAQTKYVDTIDENVEAIEKNLAESRYVPLENLANIDINNSTELMN--GENKCFAAPIRVSNVETSTFDCTTVCENESASYFFVDENDIFVINGSRLSSGGYCSTTALPTKCNRETSIVLYSVNTWTCIAEDPRFFAGESNSVQIAGRQHSRFILSGYEQYNILYDKLLENEVDITRNTLRTSWDELLDDGT.RRFVVLCNALDVNYNEMFVNPYNEIECLPNVCTNVQYAHRDVKPDFVNGVCDCGDYSVTRMQHVTSGDETSLCANIINESDYDNNVYKFRSDCLKMTDVVSKLETDGVRLFCPPDVFNTTGDAAYQVEVKGFACRTNNGVDELTYRLENDFGDRLTYIN
Q9YMK8_NPVLD/3-375 LLLVVLSVIFLYIIFKPLHGAHARIRDAQAAYDAALDERVDLIADALRRRRYVPMERLPRVNFNTNLGTLN-EGELKCMSTPVFVSAFDTPTFDCAHLCDNPTAQYFYVGAGDKFVVGDQLLEQGGYCTTSSVPRNCNRETSVVLQSLNQWTCIAEDPRYFAGPQNMSQVAGRQHAARIAPGQIERNVLFDRLLGAPVDVSRNTFRSHWDELLADGT.RRFEMRCDALDDHYNRMFVNPLNPIECLPNVCTKVNYAHPDVRPNFETGECECGDFGVTRVTHMDPNDRTSVCVGIVDAFNADALSHEFRVDCISLDTPIDEFDAS--KPLCPGTAFIQNTDAAYTFTLPGTFPISITGLHEPPHRFYMDTRSRVDYPI
Q99GT0_9NUCL/5-377 LLLFVLLVIFLYVLYRPMHLAWRFMLKAQREYNETIDDRIDYMQEVLRRRQYVPLHSLPNINFNTNLGTIN-DGELKCLSVPVFVGPVETPNFDCTETCDNPSAFYFFVGEYDKFVVNGELLDRGGYCTTNSIPRNCNRETSVILHGLNQWTCIAEDPRYFAGPQNMSQVAGRQHADRIFPGQIGRNILFDRLLGTEVDVSRNTFRSHWDELLPDGT.RRFEMRCNALDDHENRMFLNPLNPIECLPNVCTNVRRVALSVRPNFSTGECECGDVNETRVTHIVPGDKTSMCAAVVDRFNRDLMSHQLRVDCITRDMPMSKWHKD--MILCPPDVFVQNSDNAFYFTLPGSFPISETGVYEPTYRFYMQTRNRVNYDI
Q9J8A0_9NUCL/33-406 LLMIVCVVIFLFLLCKPIYDAHLEIKKSQTDYNETVDERIDYMRNVLQRRRFVPLSALPNIVFNTNLGTIN-EGESKCLSVPIYVGFSNTPNFDCTVLCDNPAAVYFYADEYDKFVINGQMLLRGGYCTTSSVPRNCNRETSVIIHSLNQWSCIAEDPRYFSGIQNINQVAGRQHIDRIAPGQANRNVLFDRLLGVEVDVTRNTFRSHWDEEMPDGSgRRFEMRCNALDDHNNRMFVNPFNPIECLPNVCTNVNFVMPDVRPNFETGECECGDFEVTRVRHLDPDDKTSMCAAVVDTFDERTLSLQYRVDCMNLDMPVEKYDRN--MLWCPSNIFNQNTDNAFLFTVPGSFPISGNGIDEPTWRLYMEMRNRIEFNV
Q9J1I7_NPVST/3-375 VVIFILLIIFVLALARPMQVAYETIRKRQIDYENRIDERIGYMQNVLSRRRYVPLSSLPNIDFGATLETIS-EGEIRCLSVPAFVSRFNTPNFDCTEMCDDPSASYFYVGPFDRFVVNGEMLTSGGYCTTNSVPRQCNRETSVIVHGLNQWTCIAEDPRYFAGEQNMIQTAGRQHIDFIRSDEIDRIVLFDRQLGVPVDVSRNTFRSHWDETMADGS.RRFEVRCDARDINNNSMFINPLNPIECLPNVCTNVQYVHPSVRPDFERGVCDCGDPDETRVVHVDPNDPSSMCASIVHNLNQSELTYEFRIECINMNTPVSRIRAN--MLLCPDHLMESTGDAAYTFVMPGAFPMSSNGIEEPNYRLWLDVRNRVNFFQ
Y022_NPVOP/4-376 ILIVLFLFALLYIVVWPFYQAFYHINHAQQDYNMTLTDRMDYIEAVMRRRQYVPMEALPVVRFDTNLGTLA-GETLRCMSVPLYVSEIDLPMFDCGEVCEDPNAVYFFVGEGDTYVVNGHKLAVGGYCTTNSVPRDCNRETSVVLMSLNQWTCIAEDPRYFAGTGNMTQLAGRQHFDRILPGQSGRNVLFDRLLGREVNVATNTFRRSWDELLEDGS.RRFEMRCNARDNNNNLMFVNPRNPLECLPNVCTDVNYVHSTVRPVFESGECDCGDEAVTRVRHVVPGDRTSMCASIVDGFDTNTASHRFRVECVNTHTPIDRFSSD--KLLCPSDTFDSNTDAAFAFEVPGSYPLSGNGLDEPTHRVFLDTRSRVQYND
Q9PYZ8_GVXN/3-374 WLLTSLFIILLYLIYSPLQRTYQQIKLETEATNKILDDP-EYLER-MIRRRYAPLHALPRVEFNASFDTLEGPGGGHCFSQPVRVSRQDLVTYDCASLCDDVRAAYFYVGPYDRLVVDGNELQEGGYCTTNSVPRNCNRETSILLHSINHWTCIAEDPRYYAGRTGLIQTAGRQHYNRIRPGFYVLNTLWDTLLDREVDPTINTFRRTWDDVNEDGT.RRFQVRCNAPDEKGNAMFVNPRNPIECLPNVCTNMQFAVRTVLPNFETGECDCGDYNDTRVTHLDRWDKSSVCVSVVDRRNVSDRSYIFRVPCISMDMPINQYRDD--VLLCPPHLINTNTDNAYEFILYGVVPLSGNDIHEPTTQLINDTRSRINWRD
Q9DVZ5_9BACU/3-368 WLGCVLVLLFIYLMYHPLHMAFYDVVDDAEERNRLLND--ETFRRQLRDRRYAPLHTLPSVSVNVD------GPATGCFSTPTLVTRNDVPSFDCSAVCGTEASAYFYVDEHRKVAVDGVLLGVGGYCTTNSVPRLCNSETSILLYGANQWTCIAEDPRYFAGEANMIQMAGRQHSELVNGEQLRKNVLWDNLLNVEVNPTANTFRRSWDDVMEDGK.RRFEVRCDALDLKHNAMFVNPYNAIECLPNVCTDVNHAHPDVRPDFVTGFCECGDQNVTRVRHIQEEDRTTKCASIVNRVHRDANTADFRVDCLSLDSPVSSFSRD--KLLCPPSIFNTNSDFAYTFTLRGVNNVSGNGIHEPTYRLWADTRSRIRWKT