EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04622 alignment
(7 sequences with 230 aa)


Q9R0C9_RAT/7-219 RRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAG-------LDHELAFSRLIVELRRLHPG-HVLP-----DEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTK--SEVYYPGETVVHGPGEATAVEWG-.PNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLF
ERG2_YEAST/1-221 MKFFPLLLLIGVVGYIMNVLFTTWLPTNYMFDPKTLNEICNSVISKHNAAEGLSTEDLLQDVRDALASHYGDEYI-----NRYVKEEWVFNNAGGAMGQMIILHASVSEYLILFGTAVGTEGHTGVHFADDYFTILHGTQIAALPYATE--AEVYTPGMTHHLKKGYAKQYSMP-.GGSFALELAQGWIPCMLPFGFLDTFSSTLDLYTLYRTVYLTARDMGKNLLQNKK
ERG2_SCHPO/2-219 KLTKFLTVFIPFIAGLIYYIQKYHLRSFYQFDPAKLQELSKQSIALYA----NDTKALLYDLSDRLVAEYGD-LITP-----VNQDEWVHNNAGGAMGTMFILHASFSEYLIFFGTPIGTEGHSGVHMADDYFTILRGRQLAASANDLE--ARVYLPGDQHVHPWGHTAQYSMPSgEPCFALELAQGWIVSMLPFGFMDGLFSTIDFGTLYKTVYFTAGRMLKSVLMGKF
ERG2_USTMA/21-241 RSWIIVSAALVGFCALIAALDS-IRSSFYIFDHKAIYKIASTAVANHPG----NATAIFDDVLDNLRA-DPKLAPYINKNHFSDESEWMFNNAGGAMGSMFIIHASVTEYLIFFGTPVGTEGHTGRHTADDYFNILTGNQYAFPAGALK--AEHYPAGSVHHLRRGTVKQYMMPE.DGCWALELAQGWIPPMLPFGLADVLSSTLDLPTFGITVWITAREMVGNLLIGKF
ERG2_NEUCR/42-256 GWLKFFAILFALVAPIAYVLEQRL-ESFYVFDTEHLHDLSKRAISRHG----NDTKAIVKYIVDELNDRNGV-APYV-----NNDEEWVFNNAGGAMGAMYIIHASITEYLIIFGTAIGTEGHTGRHTADDYFHILTGTQTAYVPGEYE--PEVYPPGSVHHLVRGTVKQYRMPE.-SCFALEYPRGWIPPMLFFGYADTLSSTLDFPTLWRTSVITGREMISNLLKGKF
ERG2_MAGGR/7-221 GFLRFVAVLLAVVSPLVYLAEQRL-ESFYVFDHKHLHELSTQAIAQHG----NNTRAIVGHIVDELRARPET-TKYI-----SVQEEWVFNNAGGAMGGMYIIHASVTEYLIIFGTAIGTEGHTGRHTADDYFNILTGEQWAYVPGEYE--PEVYPAGSVHHLRRGTVKQYKMPE.-GCFALEYARGWIPPMLFFGFADGLSSTLDFPTLWQTTVVTGREMLGNLMLGKF
O02109_CAEEL/6-200 SKLRYLLLFYAVF----QAAQFGLRWKSYDISPKQFKTIAGKAAA---A---PTISQSISTLTSGMRTYYEP--IMP--SHF----EWHAIQLGGLTLRMYPMLTAFTEFAAAFSAPFPTSGRPGLHWANTTCTVLKGKVSRFNDGTQDETSENFASGAAFRHGQFESHVYSFE-.KDTYVACYGRGFLP----------LSSTV-----HVTSGISLGEPLSVIQFYMK