EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04606 alignment
(5 sequences with 73 aa)


VPB_BP186/1-72 MFHCPKCHHAAHARTSRYLTENTKERYHQCQNINCSCTFMTMETIERFIVTPGA-IDPAPPHPTVGGQRPLWL
Q37973_9CAUD/1-72 MMHCPLCQNAAHARTSRYLSTETKERYHQCQNINCGCTFITFETLSRFIVKPGT-VDPAPPHPIRNQQQQLWL
OGRK_ECOLI/1-72 MFHCPLCQHAAHARTSRYITDTTKERYHQCQNVNCSATFITYESVQRYIVKPGE-VHVVRPHPLPSGQQIMWM
Q54420_SERMA/1-73 MMHCPLCGHVAHTRSSRYLSESTKERYHQCRNINCSCTFATHESVARVIVKPGDDIVPAQPHPPENQHKQSAA
O87909_RAHAQ/1-69 MMRCPLCNHSAHIRTSRYLSQQTKESYYQCQNIECSCTFKTIETVSKILCSPTF----EKTEGAGCNQEESYL