EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04570 alignment
(12 sequences with 59 aa)


Q9FH22_ARATH/53-111 TTDTTNLRRCYQDSGFLEHCFLCRRKLLPAKDIYMYKGDRAFCSVECRSKQMIMDEEES
Q9LMA6_ARATH/142-199 ESPAKERRVLRDCPDFLTSCCLCKKKL-QGKDIYMYKGDEGFCSKECRSLKIMEDSLKE
Q9S7C1_ARATH/119-176 EPPVIERQSVRGPTEFLSSCCLCKKKL-QGKDIYMYKGEMGFCSAECRSVQIMNDERQE
Q9SL94_ARATH/252-309 EDNKEKFGSVFPSDNFLGICNFCNKKLGGGDDIYMYR-EKSFCSEECRSEEMMIDEEDL
Q9LYE4_ARATH/256-314 PLDLTTPVDVLPPKDFLSFCYGCSKKLGMGEDIYMYSGYKAFCSSECRSKEIDLDEEME
Q9LJ91_ARATH/195-253 DPVNESDSDYSPPDSFLSCCCNCKKSLGPRDDIFMYRGDRAFCSSECRSIEMMMSEEND
Q9SGZ8_ARATH/74-132 GNLRRHSGDFSDAGHFLRSCALCERLLVPGRDIYMYRGDKAFCSSECRQEQMAQDERKE
Q9LM43_ARATH/63-110 PRGTQRRHSSDYSEDFLRSCSLCKRLLVHGRDIYMYR-----------QQQITVDERKE
Q9LV75_ARATH/42-100 HPHNPMVVMASNYDDFLKTCSLCNRSLCHHRDIYMYRGNNAFCSLECREKQIKLDEKKA
O80506_ARATH/1-59 MASYYSGFLGCEEPHFLESCSLCRKHLGLNSDIFMYRGDKAFCSNECREEQIESDEAKE
O23607_ARATH/46-104 HHQFDNSYYGYGQPHFLDSCFLCKKRLGDNRDIFMYRGDTPFCSEECREEQIERDEAKE
Q9M1W8_ARATH/186-244 VPLPQPAMETKSTESFLSRCFTCKKNLDQKQDIYIYRGEKGFCSSECRYQEMLLDQMET